Gene/Proteome Database (LMPD)
Proteins
| cholesterol 25-hydroxylase-like protein | |
|---|---|
| Refseq ID | NP_001008652 |
| Protein GI | 56693377 |
| UniProt ID | Q5PRC0 |
| mRNA ID | NM_001008652 |
| Length | 251 |
| RefSeq Status | PROVISIONAL |
| MFGLQHIWDCILQYEAQLRSPFFPVLFSITVYLSFCLPFVLLDALSPKVELIRRYKIQQKASVSWTMMWSCLALSLYNHVVYIFPLSVLHWYWRPVSYLAEAPGVLRVVWDLAACLLLFDFQYFVWHLLHHKVPWLYRTFHKVHHKYTSTFALATEYSGAWETLSLGFFAAVNPMLLGVHPMTEMLFHMLNMWLSVEDHCGYDLPWATHRLMPFGLYGGAPHHDVHHQKFKSNYAPYFTHWDKLFGTLHFE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011916 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 56693377 | RefSeq | NP_001008652 | 251 | cholesterol 25-hydroxylase-like protein |
Identical Sequences to LMP011916 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56693377 | EMBL | CAR81280.1 | 251 | unnamed protein product [Danio rerio] |
| GI:56693377 | EMBL | CBX84758.1 | 251 | unnamed protein product [Danio rerio] |
| GI:56693377 | GenBank | AAH86721.1 | 251 | Cholesterol 25-hydroxylase [Danio rerio] |
| GI:56693377 | GenBank | AAI65116.1 | 251 | Ch25h protein [Danio rerio] |
| GI:56693377 | SwissProt | Q5PRC0.1 | 251 | RecName: Full=Cholesterol 25-hydroxylase-like protein [Danio rerio] |
Related Sequences to LMP011916 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56693377 | EMBL | CDQ61409.1 | 252 | unnamed protein product [Oncorhynchus mykiss] |
| GI:56693377 | GenBank | ACI66343.1 | 252 | Cholesterol 25-hydroxylase-like protein A [Salmo salar] |
| GI:56693377 | GenBank | ADM15977.1 | 252 | Cholesterol 25-hydroxylase-like protein A [Salmo salar] |
| GI:56693377 | GenBank | ADO27958.1 | 250 | cholesterol 25-hydroxylase-like protein [Ictalurus furcatus] |
| GI:56693377 | GenBank | ADO29028.1 | 270 | cholesterol 25-hydroxylase-like protein [Ictalurus punctatus] |
| GI:56693377 | RefSeq | XP_007251207.1 | 250 | PREDICTED: cholesterol 25-hydroxylase-like protein-like [Astyanax mexicanus] |