Gene/Proteome Database (LMPD)
Proteins
| prostaglandin E synthase | |
|---|---|
| Refseq ID | NP_001014828 |
| Protein GI | 62414170 |
| UniProt ID | Q5IHX7 |
| mRNA ID | NM_001014828 |
| Length | 146 |
| RefSeq Status | PROVISIONAL |
| MLGSDIQLCFIFYSTLLILKMYIIAIITGQVRLRKKAFANPEDAERHGGVQFCRTDPYVERCRRAQQNDMENILPFLFLGAVYSMTSPSYAAAQLHFLIFFLGRVLHSVAYLLALKAPTRSLAYVIAQVPCISMAIQILMEVASFA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0050220 | IMP:ZFIN | F | prostaglandin-E synthase activity |
| GO:0042074 | IMP:ZFIN | P | cell migration involved in gastrulation |
| GO:0008152 | IMP:GOC | P | metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011935 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62414170 | RefSeq | NP_001014828 | 146 | prostaglandin E synthase |
Identical Sequences to LMP011935 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62414170 | EMBL | CAN88089.1 | 146 | prostaglandin E synthase [Danio rerio] |
| GI:62414170 | GenBank | AAW51363.1 | 146 | microsomal prostaglandin E synthase 1 [Danio rerio] |
| GI:62414170 | GenBank | AAH95159.1 | 146 | Prostaglandin E synthase [Danio rerio] |
| GI:62414170 | GenBank | AAI64946.1 | 146 | Ptges protein [Danio rerio] |
| GI:62414170 | GenBank | ADA21801.1 | 146 | Sequence 12 from patent US 7608416 |
Related Sequences to LMP011935 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62414170 | GenBank | ACO14180.1 | 150 | Prostaglandin E synthase [Esox lucius] |
| GI:62414170 | RefSeq | XP_005798737.1 | 146 | PREDICTED: prostaglandin E synthase-like [Xiphophorus maculatus] |
| GI:62414170 | RefSeq | XP_007257020.1 | 146 | PREDICTED: prostaglandin E synthase-like [Astyanax mexicanus] |
| GI:62414170 | RefSeq | XP_007549014.1 | 146 | PREDICTED: prostaglandin E synthase [Poecilia formosa] |
| GI:62414170 | RefSeq | XP_008299453.1 | 149 | PREDICTED: prostaglandin E synthase [Stegastes partitus] |
| GI:62414170 | RefSeq | XP_008421865.1 | 146 | PREDICTED: prostaglandin E synthase [Poecilia reticulata] |