Gene/Proteome Database (LMPD)
Proteins
sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating | |
---|---|
Refseq ID | NP_001017674 |
Protein GI | 62955325 |
UniProt ID | Q566U2 |
mRNA ID | NM_001017674 |
Length | 345 |
RefSeq Status | PROVISIONAL |
MATRIRPSSKRCTVIGGSGFLGRHLVERLVDRGYTVNVFDIRQAYELPGVTFYQGDLCDKLALVMALKEVSIVFHCASPAPGSDDGALFQRVNIDGTRTVIQACHEAGVQKLILTSSASVVFEGTDIKNGKEDLPYAKKPIDYYTETKIKQEKLVLEACSKEKGFLTVAIRPHGIFGPRDPQLVPILVDTARRGKMKFIIGDGSNLVDFTYVENVVHGHILAAEHLKADSPLCGQAYHITNDEPVRFWDFMSQILVGLGYSAPRYHLPYALVYGIALLLWFISLILRPLIQFKPTFSPMRVALAGTHHYYSCARAKQDMGYRPLVPLQEAVVRTVESYPHLRNGE |
Gene Information
Entrez Gene ID
Gene Name
NAD(P) dependent steroid dehydrogenase-like
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0003854 | IEA:InterPro | F | 3-beta-hydroxy-delta5-steroid dehydrogenase activity |
GO:0001878 | IDA:ZFIN | P | response to yeast |
GO:0006694 | IEA:InterPro | P | steroid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
NAD(P) dependent steroid dehydrogenase-like
Protein Entry
Q566U2_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011947 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
62955325 | RefSeq | NP_001017674 | 345 | sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating |
Identical Sequences to LMP011947 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62955325 | GenBank | AAH93332.1 | 345 | NAD(P) dependent steroid dehydrogenase-like [Danio rerio] |
GI:62955325 | GenBank | AAI64386.1 | 345 | Nsdhl protein [Danio rerio] |
Related Sequences to LMP011947 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62955325 | RefSeq | XP_005157253.1 | 345 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating isoform X1 [Danio rerio] |
GI:62955325 | RefSeq | XP_007228498.1 | 345 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating-like isoform X1 [Astyanax mexicanus] |
GI:62955325 | RefSeq | XP_007228499.1 | 345 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating-like isoform X2 [Astyanax mexicanus] |
GI:62955325 | RefSeq | XP_008298071.1 | 345 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating [Stegastes partitus] |
GI:62955325 | RefSeq | XP_009306072.1 | 395 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating isoform X2 [Danio rerio] |
GI:62955325 | RefSeq | XP_009306073.1 | 345 | PREDICTED: sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating isoform X1 [Danio rerio] |