Gene/Proteome Database (LMPD)
LMPD ID
LMP011961
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
fat storage-inducing transmembrane protein 2
Gene Symbol
Synonyms
fit2; wu:fc04g08; wu:fr13b05; zgc:110840
Alternate Names
fat storage-inducing transmembrane protein 2; fat-inducing protein 2; fat-inducing transcript 2
Chromosome
23
Proteins
| fat storage-inducing transmembrane protein 2 | |
|---|---|
| Refseq ID | NP_001018334 |
| Protein GI | 66472716 |
| UniProt ID | Q52KL1 |
| mRNA ID | NM_001020498 |
| Length | 252 |
| RefSeq Status | PROVISIONAL |
| MAAAVAGSLVDKLVCLWRQPYTRIYLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNFYIKSHMFALRRLTSLLVATLVWYICTETFFYIEDITGSCYESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEEMVPMLHIQPAYRNPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYVKLFSPGLPPQPKQHT | |
Gene Information
Entrez Gene ID
Gene Name
fat storage-inducing transmembrane protein 2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0007010 | ISS:UniProtKB | P | cytoskeleton organization |
| GO:0019915 | IMP:ZFIN | P | lipid storage |
| GO:0022604 | ISS:UniProtKB | P | regulation of cell morphogenesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019388 | Fat storage-inducing transmembrane protein |
UniProt Annotations
Entry Information
Gene Name
fat storage-inducing transmembrane protein 2
Protein Entry
FITM2_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | May play a role in the regulation of cell morphology and cytoskeletal organization (By similarity). Plays an important role in lipid droplet accumulation in liver and intestine during embryogenesis. {ECO:0000250, ECO:0000269|PubMed:18160536}. |
| Similarity | Belongs to the FIT family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Tissue Specificity | Widely expressed. {ECO:0000269|PubMed:18160536}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011961 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 66472716 | RefSeq | NP_001018334 | 252 | fat storage-inducing transmembrane protein 2 |
Identical Sequences to LMP011961 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66472716 | GenBank | AAH94293.1 | 252 | Fat-inducing transcript 2 [Danio rerio] |
| GI:66472716 | SwissProt | Q52KL1.1 | 252 | RecName: Full=Fat storage-inducing transmembrane protein 2; AltName: Full=Fat-inducing protein 2 [Danio rerio] |
Related Sequences to LMP011961 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:66472716 | GenBank | AAI54268.1 | 252 | Fit2 protein [Danio rerio] |
| GI:66472716 | GenBank | AHH38582.1 | 257 | Fat storage-inducing transmembrane protein 2 [Ictalurus punctatus] |
| GI:66472716 | RefSeq | XP_005741075.1 | 260 | PREDICTED: fat storage-inducing transmembrane protein 2-like [Pundamilia nyererei] |
| GI:66472716 | RefSeq | XP_006794060.1 | 260 | PREDICTED: fat storage-inducing transmembrane protein 2-like [Neolamprologus brichardi] |
| GI:66472716 | RefSeq | XP_007238884.1 | 259 | PREDICTED: fat storage-inducing transmembrane protein 2 [Astyanax mexicanus] |
| GI:66472716 | RefSeq | XP_008286220.1 | 260 | PREDICTED: fat storage-inducing transmembrane protein 2 [Stegastes partitus] |