Gene/Proteome Database (LMPD)
Proteins
| alpha-N-acetylneuraminide alpha-2,8-sialyltransferase | |
|---|---|
| Refseq ID | NP_001075101 |
| Protein GI | 125995402 |
| UniProt ID | A1A5W4 |
| mRNA ID | NM_001081632 |
| Length | 145 |
| RefSeq Status | PROVISIONAL |
| MVSLRCHRSKYIWATLGVLALLWLYIFPVYRIPSDKEMVEEVLRQGQTWSRNQTAVELYRKLLTDCCNPKRMFAVTKENSPLGKVLWYDGEFYHYHTVTNETYPIFVQDTPLQLPLKRCSVVGNGGVLKHSGCGNEIDRADFIMR | |
Gene Information
Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
A1A5W4_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011965 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 125995402 | RefSeq | NP_001075101 | 145 | alpha-N-acetylneuraminide alpha-2,8-sialyltransferase |
Identical Sequences to LMP011965 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:125995402 | GenBank | AAI28838.1 | 145 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Danio rerio] |
Related Sequences to LMP011965 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:125995402 | EMBL | CAG29374.1 | 339 | alpha-2,8-sialyltransferase ST8Sia I, partial [Danio rerio] |
| GI:125995402 | EMBL | CAM56534.1 | 339 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Danio rerio] |
| GI:125995402 | GenBank | AHH40000.1 | 331 | Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Ictalurus punctatus] |
| GI:125995402 | RefSeq | XP_003445001.1 | 335 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase-like isoform X1 [Oreochromis niloticus] |
| GI:125995402 | RefSeq | XP_005170863.1 | 339 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform X1 [Danio rerio] |
| GI:125995402 | RefSeq | XP_007235021.1 | 337 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase-like [Astyanax mexicanus] |