Gene/Proteome Database (LMPD)
Proteins
| HCLS1-binding protein 3 | |
|---|---|
| Refseq ID | NP_001243150 |
| Protein GI | 371940962 |
| UniProt ID | Q6DHB3 |
| mRNA ID | NM_001256221 |
| Length | 349 |
| RefSeq Status | PROVISIONAL |
| MSDGRITSRPLQNEATGIDLHVPLYQEIRGSVITGHVEYQIVVVTCLSSFKSAIHKTGDVLQFVVSKKYSEIEQLYYSLKTKYPSIHLPPMPRKALFVSETDLCNRRVAFDELVKFLSKHPLLANCPELLEFLGAKTTAVEVKTINKPDFIEKEVDDGLDFFESGDPLQKPSEDVELLDPLGSEWLKKDVKPKDVCPVGKCVPKPKSETLFEEEDDTELFSPAKKGHVMLFDNTPLRSIDSSPFSNTSNGIKMTESKVDEDIEELLSVEMDLHKHLSVSKTVRCRPDTAMNPMKPKVKSKPVASERTSNLTQATDLQLSGTEVMNQMDILQYIQQNDLPASEDLDLFKS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0035091 | IEA:InterPro | F | phosphatidylinositol binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001683 | Phox homologous domain |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011968 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 371940962 | RefSeq | NP_001243150 | 349 | HCLS1-binding protein 3 |
Identical Sequences to LMP011968 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP011968 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:371940962 | EMBL | CDQ87057.1 | 372 | unnamed protein product [Oncorhynchus mykiss] |
| GI:371940962 | GenBank | AAH76062.1 | 365 | LOC553223 protein, partial [Danio rerio] |
| GI:371940962 | GenBank | AAI33870.1 | 364 | LOC553223 protein, partial [Danio rerio] |
| GI:371940962 | RefSeq | XP_007257374.1 | 402 | PREDICTED: HCLS1-binding protein 3 isoform X1 [Astyanax mexicanus] |
| GI:371940962 | RefSeq | XP_007257375.1 | 390 | PREDICTED: HCLS1-binding protein 3 isoform X2 [Astyanax mexicanus] |
| GI:371940962 | RefSeq | XP_007257376.1 | 359 | PREDICTED: HCLS1-binding protein 3 isoform X3 [Astyanax mexicanus] |