Gene/Proteome Database (LMPD)
Proteins
| RAR-related orphan receptor A, paralog b | |
|---|---|
| Refseq ID | NP_957361 |
| Protein GI | 41055082 |
| UniProt ID | Q7ZU39 |
| mRNA ID | NM_201067 |
| Length | 474 |
| RefSeq Status | PROVISIONAL |
| MYLMITAMKAQIESIPCKICGDKSSGIHYGVITCEGCKGFFRGSQQGTVSYSCPRQKSCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLFAEVQKHRNDDKTGDESEKNQESQAPGEAEPLTPSYALSSSGVTEIPDDLSGYVNGQTQEEGKADSAIGGFYLDIQPSPDQSGLDMDGIKLEPVCDLSSDSGLDQYCCYSNGDASPPHDDLEHLSENICKSHLETCQYLREELQPSNWQTVLQSNLEAYQKKSQEDMWQLCAVKVTEAVQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFVRMCRAYNSQNNTVFFDSKYAGPEVFKALGCDDLISSVFEFAKSLNSLQLSEDEIGLFSAYVLMSADRSWLQEKTRVEKLQQKIKIALQNLLQKNQRDEGILTKLVCKVSTVRMLCRHHMEKLSAFRALYPEMVHTRFPPLYKELFGSDFEQILPQEA | |
Gene Information
Entrez Gene ID
Gene Name
RAR-related orphan receptor A, paralog b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0004879 | IEA:InterPro | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
RAR-related orphan receptor A, paralog b
Protein Entry
Q7ZU39_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012005 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41055082 | RefSeq | NP_957361 | 474 | RAR-related orphan receptor A, paralog b |
Identical Sequences to LMP012005 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41055082 | GenBank | AAH51158.1 | 474 | RAR-related orphan receptor A, paralog b [Danio rerio] |
Related Sequences to LMP012005 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41055082 | GenBank | AAI59204.1 | 492 | Rorab protein [Danio rerio] |
| GI:41055082 | GenBank | AFC34771.1 | 474 | RORalpha1 [Ctenopharyngodon idella] |
| GI:41055082 | RefSeq | XP_004553201.1 | 468 | PREDICTED: nuclear receptor ROR-alpha-like isoform X2 [Maylandia zebra] |
| GI:41055082 | RefSeq | XP_007242390.1 | 463 | PREDICTED: nuclear receptor ROR-alpha-like, partial [Astyanax mexicanus] |
| GI:41055082 | RefSeq | XP_008280365.1 | 468 | PREDICTED: nuclear receptor ROR-alpha isoform X2 [Stegastes partitus] |
| GI:41055082 | RefSeq | XP_009301491.1 | 526 | PREDICTED: RAR-related orphan receptor A, paralog b isoform X1 [Danio rerio] |