Gene/Proteome Database (LMPD)
Proteins
| prostaglandin D2 synthase a precursor | |
|---|---|
| Refseq ID | NP_001186920 |
| Protein GI | 317008588 |
| UniProt ID | B3DI79 |
| mRNA ID | NM_001199991 |
| Length | 190 |
| RefSeq Status | PROVISIONAL |
| MKVTIFLLMILKEVHANVQPQKNFDLQRFAGRWYRIGLAYDSPGFVPHRSKVTISMGTVEPQDNGNVNMTMWSLTSSGCKQKIYIYEKTSVSGVFNYYSTRHRRMKDVTVVETNYSEYAMVVKHKKMNKEYTQVSLYGRAKKLKADLMEKFRAYATALGFSKESILTPPTARNCPPKEASQSFIQVKAGY | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0036094 | IEA:InterPro | F | small molecule binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin D2 synthase a
Protein Entry
B3DI79_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012014 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 317008588 | RefSeq | NP_001186920 | 190 | prostaglandin D2 synthase a precursor |
Identical Sequences to LMP012014 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:317008588 | GenBank | AAI63043.1 | 190 | LOC555483 protein [Danio rerio] |
| GI:317008588 | GenBank | AAI63029.1 | 190 | LOC555483 protein [Danio rerio] |
Related Sequences to LMP012014 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:317008588 | EMBL | CDQ89262.1 | 169 | unnamed protein product [Oncorhynchus mykiss] |
| GI:317008588 | GenBank | ACQ58872.1 | 185 | Lipocalin precursor [Anoplopoma fimbria] |
| GI:317008588 | RefSeq | XP_004074883.1 | 219 | PREDICTED: lipocalin-like [Oryzias latipes] |
| GI:317008588 | RefSeq | XP_005729347.1 | 182 | PREDICTED: prostaglandin-H2 D-isomerase-like [Pundamilia nyererei] |
| GI:317008588 | RefSeq | XP_005938863.1 | 182 | PREDICTED: prostaglandin-H2 D-isomerase-like [Haplochromis burtoni] |
| GI:317008588 | RefSeq | XP_006640656.1 | 309 | PREDICTED: lipocalin-like [Lepisosteus oculatus] |