Gene/Proteome Database (LMPD)
Proteins
| glycolipid transfer protein | |
|---|---|
| Refseq ID | NP_001093458 |
| Protein GI | 153792401 |
| UniProt ID | A2BG43 |
| mRNA ID | NM_001099988 |
| Length | 209 |
| RefSeq Status | PROVISIONAL |
| MALLMEHQFRQLPADKQVETRPFLEAVSHLPPFFDCLGSAVFSPIKADIAGNITKIKAVYDSNPTRFKTLQQILEAEKEMHGAEWPKVGATLALMWLKRGLRFIQVLLQSLVDGDKDDNNPNLIKVNVTKAYEMALKKYHGWIVQKLFQAALYAAPYRSDFLRALSKGREVKDEECLDKVRQFLVNFTATNDAIYEMYTKMNADLDYKV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0051861 | IEA:InterPro | F | glycolipid binding |
| GO:0017089 | IEA:InterPro | F | glycolipid transporter activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR014830 | Glycolipid transfer protein domain |
UniProt Annotations
Entry Information
Gene Name
glycolipid transfer protein a
Protein Entry
GLTP_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the GLTP family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012038 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 153792401 | RefSeq | NP_001093458 | 209 | glycolipid transfer protein |
Identical Sequences to LMP012038 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:153792401 | SwissProt | A2BG43.1 | 209 | RecName: Full=Glycolipid transfer protein; Short=GLTP [Danio rerio] |
Related Sequences to LMP012038 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:153792401 | RefSeq | XP_003451702.1 | 209 | PREDICTED: glycolipid transfer protein-like isoform X1 [Oreochromis niloticus] |
| GI:153792401 | RefSeq | XP_005473380.1 | 209 | PREDICTED: glycolipid transfer protein-like isoform X2 [Oreochromis niloticus] |
| GI:153792401 | RefSeq | XP_005940246.1 | 209 | PREDICTED: glycolipid transfer protein-like isoform X1 [Haplochromis burtoni] |
| GI:153792401 | RefSeq | XP_006784295.1 | 209 | PREDICTED: glycolipid transfer protein-like [Neolamprologus brichardi] |
| GI:153792401 | RefSeq | XP_007233550.1 | 209 | PREDICTED: glycolipid transfer protein [Astyanax mexicanus] |
| GI:153792401 | RefSeq | XP_008274821.1 | 209 | PREDICTED: glycolipid transfer protein [Stegastes partitus] |