Gene/Proteome Database (LMPD)
Proteins
| prostaglandin G/H synthase 2 precursor | |
|---|---|
| Refseq ID | NP_001020675 |
| Protein GI | 70887621 |
| UniProt ID | Q5RI06 |
| mRNA ID | NM_001025504 |
| Length | 606 |
| RefSeq Status | PROVISIONAL |
| MKSSVLFIFLLLGFVVCTGANPCCSHPCQNRGVCTEMGSDAYECDCTRTGYYGQNCTTPEFLTWVKVSLKPSPNTVHYILTHFKSLWNIINNVSFLRNGIMRYVLTSRAHLIDSPPTFNADYGYKSWEAYSNLSYYTRTLPPVPRDCPTPMGVAGKKELPDVKMLAEKLLLRRKFIPDPQRTNLMFAFFAQHFTHQFFKSDMKKGPAFTTALNHGVDLAHIYGQNLDRQHKLRLFKDGKLRYQILDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAFGLVPGLMMYATIWLREHNRVCDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFNERFQYQNRISSEFNTLYHWHPLMPDDFHIQDEVYNYQQFLFNTSILTDYGVNSLVESFNKQIAGRVAGGRNVAPAVLRVAIKSIENSRQMRYQSINAYRKRFNMKPYRSFEEMTGEKEMAAELEEMYGDVDAVELYAGLLVEKPRSNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGGKVGFEIVNSASLQNLVCNNVNGPCPMASFYVPNVKDSLPTTINASTSQSDRNVNPTVLLKERTSEL | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin-endoperoxide synthase 2b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0004601 | IDA:ZFIN | F | peroxidase activity |
| GO:0004666 | IEA:InterPro | F | prostaglandin-endoperoxide synthase activity |
| GO:0071407 | IDA:ZFIN | P | cellular response to organic cyclic compound |
| GO:0019371 | IEA:InterPro | P | cyclooxygenase pathway |
| GO:0006954 | IEA:InterPro | P | inflammatory response |
| GO:0008217 | IEA:InterPro | P | regulation of blood pressure |
| GO:0006979 | IEA:InterPro | P | response to oxidative stress |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin-endoperoxide synthase 2b
Protein Entry
Q5RI06_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012051 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 70887621 | RefSeq | NP_001020675 | 606 | prostaglandin G/H synthase 2 precursor |
Identical Sequences to LMP012051 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70887621 | GenBank | ABF50051.1 | 606 | prostaglandin G/H synthase 2b [Danio rerio] |
| GI:70887621 | GenBank | AAI39569.1 | 606 | Prostaglandin-endoperoxide synthase 2b [Danio rerio] |
Related Sequences to LMP012051 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70887621 | GenBank | ABN11283.1 | 609 | prostaglandin G/H synthase 2b [Oncorhynchus mykiss] |
| GI:70887621 | GenBank | ACR44352.2 | 608 | cyclooxygenase 2 [Oplegnathus fasciatus] |
| GI:70887621 | GenBank | AHH39826.1 | 607 | Prostaglandin G/H synthase 2 [Ictalurus punctatus] |
| GI:70887621 | RefSeq | NP_001118139.1 | 609 | prostaglandin G/H synthase 2 precursor [Oncorhynchus mykiss] |
| GI:70887621 | RefSeq | XP_005803955.1 | 609 | PREDICTED: prostaglandin G/H synthase 2-like [Xiphophorus maculatus] |
| GI:70887621 | RefSeq | XP_007245479.1 | 608 | PREDICTED: prostaglandin G/H synthase 2-like [Astyanax mexicanus] |