Gene/Proteome Database (LMPD)
Proteins
| uncharacterized protein LOC561776 | |
|---|---|
| Refseq ID | NP_001077018 |
| Protein GI | 320043225 |
| UniProt ID | F1Q7H8 |
| mRNA ID | NM_001083549 |
| Length | 357 |
| RefSeq Status | VALIDATED |
| MAPSHAVRCCQRGLSWIPVIFINLVVCWSYYAYVVELCIYTIPNVNEQVIYLVVFHAFFFMFMWSYWKTISSKPTNPSKEFCLPKAEKELYEKEERPEAQQDILKRVARELPIYTFTGSGAIRYCDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYIAATVLQYFIKFWTNQLPDTHAKFHVLFLFFVAAMFFISILSLFSYHLWLVGKNRTTIEAFRAPVFRNGPDKNGFTLGFRKNITQVFGDQKKYWCLPIFSSLGDGYTFPTRLVTVDVEHGNIEHQTIKCTVDGQTNARPLSESQNHLLCNDEGQKDSSMAAIEVCQPVCVTLENES | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 20a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 20a
Protein Entry
F1Q7H8_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012081 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 320043225 | RefSeq | NP_001077018 | 357 | uncharacterized protein LOC561776 |
Identical Sequences to LMP012081 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP012081 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:320043225 | EMBL | CBN81884.1 | 355 | Probable palmitoyltransferase ZDHHC20 [Dicentrarchus labrax] |
| GI:320043225 | GenBank | AAI24428.1 | 348 | Zgc:162723 protein, partial [Danio rerio] |
| GI:320043225 | GenBank | AAI34070.1 | 357 | Zgc:162723 protein [Danio rerio] |
| GI:320043225 | RefSeq | XP_005172729.1 | 369 | PREDICTED: uncharacterized protein LOC561776 isoform X1 [Danio rerio] |
| GI:320043225 | RefSeq | XP_008296777.1 | 397 | PREDICTED: probable palmitoyltransferase ZDHHC20 isoform X1 [Stegastes partitus] |
| GI:320043225 | RefSeq | XP_008296778.1 | 363 | PREDICTED: probable palmitoyltransferase ZDHHC20 isoform X2 [Stegastes partitus] |