Gene/Proteome Database (LMPD)
Proteins
| acyl-CoA:lysophosphatidylglycerol acyltransferase 1 | |
|---|---|
| Refseq ID | NP_001025129 |
| Protein GI | 71480068 |
| UniProt ID | Q4KMD5 |
| mRNA ID | NM_001029958 |
| Length | 371 |
| RefSeq Status | PROVISIONAL |
| MAPHLDVARKLVWILIKSLLRFTFMFVNNCVAIPSYCLYLIVLQPLRVLDAQTFWYIEGVMFRWLLAMVASWGWCAGYTVTEWGDDVSPMTEDEAMVIVNHQATGDVCTLMMCLQDKGTVVRKMMWLMDHVFKYTNFGVVSLIHGDFFIRQGKAHREKQLVYLKDHLDKFYYSRDRKWIVLFPEGGFLRKRRETSQSFAKKNDLPYLTHVTLPRLGATQIILKNLGPQQENGILGTDGSPPGQSNKPKGLQWVIDMTIAYPNARPMDIQTWIFGYRDPTVTHVHYRTYPIKDVPVDSEALTDWLYQRFVEKEKLLAHFYETGAFPPLDGQKEMVSREMTLDNAWLFLVQTFAFASGYMWYSILHHIYFWLF | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylglycerol acyltransferase 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016746 | IEA:InterPro | F | transferase activity, transferring acyl groups |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylglycerol acyltransferase 1
Protein Entry
Q4KMD5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012085 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 71480068 | RefSeq | NP_001025129 | 371 | acyl-CoA:lysophosphatidylglycerol acyltransferase 1 |
Identical Sequences to LMP012085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71480068 | GenBank | AAH98616.1 | 371 | Si:dkey-30h14.2 [Danio rerio] |
| GI:71480068 | RefSeq | XP_005160496.1 | 371 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X1 [Danio rerio] |
Related Sequences to LMP012085 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71480068 | RefSeq | XP_004568773.1 | 372 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1-like isoform X1 [Maylandia zebra] |
| GI:71480068 | RefSeq | XP_005475031.1 | 372 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1-like isoform X1 [Oreochromis niloticus] |
| GI:71480068 | RefSeq | XP_005921615.1 | 372 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1-like isoform X1 [Haplochromis burtoni] |
| GI:71480068 | RefSeq | XP_007255560.1 | 376 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X1 [Astyanax mexicanus] |
| GI:71480068 | RefSeq | XP_007255561.1 | 376 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X2 [Astyanax mexicanus] |
| GI:71480068 | RefSeq | XP_008288566.1 | 372 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 [Stegastes partitus] |