Gene/Proteome Database (LMPD)
Proteins
| phosphatidylcholine transfer protein | |
|---|---|
| Refseq ID | NP_001124258 |
| Protein GI | 195546822 |
| UniProt ID | B3DIL4 |
| mRNA ID | NM_001130786 |
| Length | 214 |
| RefSeq Status | PROVISIONAL |
| MALAFSDEEFQQAWTELDEPQLDGGWEFFTETMNVKIYRLYNKETGLYEYKVFGSLSGCSPELCAEVYMDLNYRRQWDSYVKELHEKDYNDQKAIYWEVKYPMPLSNRDYVYVRERRDLDVSGRKICVVLAKSTSVSQCPEKRGVIRVKDYKQSLAIESDGSGGTKMFMNYFDNPGGMIPTWLVNWAAKTGVPSFLTDMKKACSNYSDYCKNSK | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylcholine transfer protein
Protein Entry
B3DIL4_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012121 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 195546822 | RefSeq | NP_001124258 | 214 | phosphatidylcholine transfer protein |
Identical Sequences to LMP012121 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195546822 | GenBank | AAI63168.1 | 214 | Similar to Phosphatidylcholine transfer protein (PC-TP) (StAR-related lipid transfer protein 2) (StARD2) (START domain-containing protein 2) [Danio rerio] |
| GI:195546822 | GenBank | AAI63179.1 | 214 | Similar to Phosphatidylcholine transfer protein (PC-TP) (StAR-related lipid transfer protein 2) (StARD2) (START domain-containing protein 2) [Danio rerio] |
Related Sequences to LMP012121 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:195546822 | GenBank | ACO08428.1 | 215 | Phosphatidylcholine transfer protein [Oncorhynchus mykiss] |
| GI:195546822 | RefSeq | NP_001158715.1 | 215 | Phosphatidylcholine transfer protein [Oncorhynchus mykiss] |
| GI:195546822 | RefSeq | XP_003442540.1 | 213 | PREDICTED: phosphatidylcholine transfer protein-like [Oreochromis niloticus] |
| GI:195546822 | RefSeq | XP_005924228.1 | 213 | PREDICTED: phosphatidylcholine transfer protein-like [Haplochromis burtoni] |
| GI:195546822 | RefSeq | XP_009297444.1 | 214 | PREDICTED: phosphatidylcholine transfer protein isoform X1 [Danio rerio] |
| GI:195546822 | RefSeq | XP_009297445.1 | 214 | PREDICTED: phosphatidylcholine transfer protein isoform X1 [Danio rerio] |