Gene/Proteome Database (LMPD)
Proteins
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 | |
---|---|
Refseq ID | NP_001073656 |
Protein GI | 122114579 |
UniProt ID | A1L293 |
mRNA ID | NM_001080187 |
Length | 183 |
RefSeq Status | PROVISIONAL |
MSSVLARILFYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVITMNEEYETKYFCNSAEEWQSVGVEQIRLDTVDLTGVPSLEHIHKGVDFALRHREQGSSVYIHCKAGRSRSATIAAAYLIRLHCWSPEEACKMLASVRPHVLIRSSQLEMLQKYYKQVCDSESS |
Gene Information
Entrez Gene ID
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IBA:RefGenome | C | mitochondrion |
GO:0004439 | IBA:RefGenome | F | phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity |
GO:0004725 | IEA:InterPro | F | protein tyrosine phosphatase activity |
GO:0008138 | IBA:RefGenome | F | protein tyrosine/serine/threonine phosphatase activity |
GO:0046855 | IBA:RefGenome | P | inositol phosphate dephosphorylation |
GO:0006470 | IBA:RefGenome | P | protein dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Protein Entry
A1L293_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012124 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
122114579 | RefSeq | NP_001073656 | 183 | phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 |
Identical Sequences to LMP012124 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:122114579 | GenBank | AAI29408.1 | 183 | Protein tyrosine phosphatase, mitochondrial 1 [Danio rerio] |
Related Sequences to LMP012124 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:122114579 | EMBL | CDQ59872.1 | 183 | unnamed protein product [Oncorhynchus mykiss] |
GI:122114579 | RefSeq | XP_003456936.1 | 182 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Oreochromis niloticus] |
GI:122114579 | RefSeq | XP_003969799.1 | 182 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Takifugu rubripes] |
GI:122114579 | RefSeq | XP_004566405.1 | 182 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Maylandia zebra] |
GI:122114579 | RefSeq | XP_005746754.1 | 182 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Pundamilia nyererei] |
GI:122114579 | RefSeq | XP_006804499.1 | 182 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Neolamprologus brichardi] |