Gene/Proteome Database (LMPD)
Proteins
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex 1-like | |
---|---|
Refseq ID | NP_001003418 |
Protein GI | 51010919 |
UniProt ID | Q6DH81 |
mRNA ID | NM_001003418 |
Length | 155 |
RefSeq Status | PROVISIONAL |
MAARILARCVRSLNHRSLYFNRVNTVATLTAAPLIHGRTLSHLTTGHKSSLAQVSGSSLQIFQWRQFCDSPPLTLKTVHERVLYVLKLYDKINPEKLQVTSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDEDAEKLMTPEQVVQYIAEKKEVHE |
Gene Information
Entrez Gene ID
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1a
Protein Entry
Q6DH81_DANRE
UniProt ID
Species
Zebrafish
Comments
Comment Type | Description |
---|---|
Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
Similarity | Contains 1 acyl carrier domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012179 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
51010919 | RefSeq | NP_001003418 | 155 | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex 1-like |
Identical Sequences to LMP012179 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:51010919 | GenBank | AAH76098.1 | 155 | Zgc:92607 [Danio rerio] |
Related Sequences to LMP012179 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:51010919 | GenBank | AAI52173.1 | 155 | Zgc:92607 protein [Danio rerio] |
GI:51010919 | GenBank | AAI55384.1 | 155 | LOC100127785 protein [Xenopus (Silurana) tropicalis] |
GI:51010919 | RefSeq | NP_001106574.1 | 155 | uncharacterized protein LOC100127785 [Xenopus (Silurana) tropicalis] |
GI:51010919 | RefSeq | XP_004071796.1 | 155 | PREDICTED: acyl carrier protein, mitochondrial-like isoform 1 [Oryzias latipes] |
GI:51010919 | RefSeq | XP_005806129.1 | 156 | PREDICTED: acyl carrier protein, mitochondrial-like isoform X2 [Xiphophorus maculatus] |
GI:51010919 | RefSeq | XP_007238193.1 | 154 | PREDICTED: acyl carrier protein, mitochondrial [Astyanax mexicanus] |