Gene/Proteome Database (LMPD)
Proteins
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | |
|---|---|
| Refseq ID | NP_001070121 |
| Protein GI | 115496282 |
| UniProt ID | Q08C19 |
| mRNA ID | NM_001076653 |
| Length | 265 |
| RefSeq Status | PROVISIONAL |
| MDALLNTLFSSEEEELYVLDCLSYLMMAMALITFVALLFEHVPYGRYASSRFGFPVNVKLAWFVQELPSFLLPLSLALWSSSSKIIHLPNQLLLLMFVCHYMQRSLIYPFLIRGGKSTPFISLVLAFVFCIYNGYLQGRYLSHYADYPADWVTHPCFIIGSCMWFLGWIINMHSDHILRNLRKPGETGYKIPRGGMFEYVSGANFFGEIVEWAGFALAGQSIHSAAFALFTLIVLSSRGMDHHKWYLTKFEDYPKSRKALIPFLL | |
Gene Information
Entrez Gene ID
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:InterPro | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | IEA:InterPro | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0008202 | IEA:InterPro | P | steroid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Protein Entry
Q08C19_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012210 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 115496282 | RefSeq | NP_001070121 | 265 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Identical Sequences to LMP012210 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:115496282 | GenBank | AAI24452.1 | 265 | Steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [Danio rerio] |
| GI:115496282 | GenBank | AAI64429.1 | 265 | Srd5a1 protein [Danio rerio] |
Related Sequences to LMP012210 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:115496282 | EMBL | CDQ83707.1 | 265 | unnamed protein product [Oncorhynchus mykiss] |
| GI:115496282 | RefSeq | XP_007231775.1 | 265 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Astyanax mexicanus] |
| GI:115496282 | RefSeq | XP_008293391.1 | 265 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Stegastes partitus] |
| GI:115496282 | RefSeq | XP_009292518.1 | 265 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform X1 [Danio rerio] |
| GI:115496282 | RefSeq | XP_009292519.1 | 265 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform X1 [Danio rerio] |
| GI:115496282 | RefSeq | XP_009292520.1 | 231 | PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform X2 [Danio rerio] |