Gene/Proteome Database (LMPD)
Proteins
| nuclear receptor subfamily 0 group B member 1 | |
|---|---|
| Refseq ID | NP_001076416 |
| Protein GI | 130497366 |
| UniProt ID | A3KNP5 |
| mRNA ID | NM_001082947 |
| Length | 264 |
| RefSeq Status | PROVISIONAL |
| MAYFDSGCHCSSERRQNSILYSILKNDSQSAQLGNQPRAPRLAVSMRACACGSKRKVSLRSPQTTCKAASAVLVKTLKFVKNVPCFRELPADDQHTLVRSGWAPLLVLGMAQDRIDFETSETQEPSMLQRILTSGQDKQDNQSHNGGVALTDVQGIKMFLRKCWGLDISTKEYAYLKGAILFNPDVAGLQCQHYIQALQSEANQALNEYVKMIHRGDSARFAKLFLALSMLRSINANVVAGLFFKPVIGAVNMEELLLEMFYGK | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 0, group B, member 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0003677 | IEA:InterPro | F | DNA binding |
| GO:0003700 | IEA:InterPro | F | sequence-specific DNA binding transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 0, group B, member 1
Protein Entry
A3KNP5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012291 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 130497366 | RefSeq | NP_001076416 | 264 | nuclear receptor subfamily 0 group B member 1 |
Identical Sequences to LMP012291 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:130497366 | GenBank | AAI33943.1 | 264 | LOC100001692 protein [Danio rerio] |
Related Sequences to LMP012291 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:130497366 | EMBL | CCP19127.1 | 261 | dosage sensitive sex-reversal-adrenal hypoplasia congenital-critical region of X chromosome, gene 1 [Latimeria menadoensis] |
| GI:130497366 | GenBank | ACT79291.1 | 173 | Dax-1, partial [Squalius alburnoides] |
| GI:130497366 | GenBank | AFV60024.1 | 194 | orphan nuclear receptor DAX1 [Carassius auratus ssp. 'Pengze'] |
| GI:130497366 | RefSeq | XP_006008193.1 | 261 | PREDICTED: nuclear receptor subfamily 0 group B member 1 [Latimeria chalumnae] |
| GI:130497366 | RefSeq | XP_006639240.1 | 260 | PREDICTED: nuclear receptor subfamily 0 group B member 1-like [Lepisosteus oculatus] |
| GI:130497366 | RefSeq | XP_007259454.1 | 270 | PREDICTED: nuclear receptor subfamily 0 group B member 1-like [Astyanax mexicanus] |