Gene/Proteome Database (LMPD)
Proteins
| lysosomal thioesterase PPT2 precursor | |
|---|---|
| Refseq ID | NP_001103329 |
| Protein GI | 237681324 |
| UniProt ID | A3KPZ6 |
| mRNA ID | NM_001109859 |
| Length | 287 |
| RefSeq Status | PROVISIONAL |
| MKGACVWTLVSVCVFCVCVAYKPVIVVHGLFDSSADFVHLHRFINLSHPGTNVTVLDLFDRSASLQPLWKQVEGFTEAIYPIMQNAADGVHLICYSQGGLVCRGILSTLPDHNVHSFISLSAPQAGQYGDTDYLKYLFPQFVKSNLFHVCYTAVGQKISICNYWNDPHHRDMYINSSDYLALLNNERPNPNSTAWKQNFLRIKKLVLIGGPDDGVITPWQSSQFGFYDDNETVVEMKNQKVFLMDLFGLKTLSARGDLALCSVEGVAHIFWHSNETVYKTCIEKWLT | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl-protein thioesterase 2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008474 | IEA:InterPro | F | palmitoyl-(protein) hydrolase activity |
| GO:0006464 | IEA:InterPro | P | cellular protein modification process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl-protein thioesterase 2
Protein Entry
A3KPZ6_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP012322 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 237681324 | RefSeq | NP_001103329 | 287 | lysosomal thioesterase PPT2 precursor |
Identical Sequences to LMP012322 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:237681324 | EMBL | CAM56702.1 | 287 | novel protein similar to verebrate palmitoyl-protein thioesterase 2 (PPT2) [Danio rerio] |
Related Sequences to LMP012322 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:237681324 | RefSeq | XP_004549044.1 | 305 | PREDICTED: lysosomal thioesterase PPT2-A-like [Maylandia zebra] |
| GI:237681324 | RefSeq | XP_005817155.1 | 301 | PREDICTED: lysosomal thioesterase PPT2-A-like [Xiphophorus maculatus] |
| GI:237681324 | RefSeq | XP_006788110.1 | 305 | PREDICTED: lysosomal thioesterase PPT2-A-like [Neolamprologus brichardi] |
| GI:237681324 | RefSeq | XP_007239778.1 | 289 | PREDICTED: lysosomal thioesterase PPT2-A-like isoform X1 [Astyanax mexicanus] |
| GI:237681324 | RefSeq | XP_007239779.1 | 289 | PREDICTED: lysosomal thioesterase PPT2-A-like isoform X2 [Astyanax mexicanus] |
| GI:237681324 | RefSeq | XP_008289761.1 | 303 | PREDICTED: lysosomal thioesterase PPT2-A-like [Stegastes partitus] |