Gene/Proteome Database (LMPD)
Proteins
| elongation of very long chain fatty acids-like 6-like | |
|---|---|
| Refseq ID | NP_958908 |
| Protein GI | 41393157 |
| UniProt ID | Q802X6 |
| mRNA ID | NM_201500 |
| Length | 268 |
| RefSeq Status | PROVISIONAL |
| MNMTDFQLPLTEYEFERHFDERLAIEWMQDNWKKSFLFGAVYVVLVFGGQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFMLYILSTSGFKQSVCDQSFYYGPISKFWACAFVLSKAPELGDTMFIVLRKQRLIFLHWYHHITVLVYSWYSYKDQVAGGGWFMTMNYTVHALMYSYYAARAAGLRVPKPCAILITSSQIAQMAMDLAVSALVYRWMQDGDCPSYLDNIVWASLMYLSYLLLFSSFFYQSYMKSSKPESIKRE | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL family member 6, elongation of long chain fatty acids like
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
ELOVL family member 6, elongation of long chain fatty acids like
Protein Entry
Q802X6_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012333 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41393157 | RefSeq | NP_958908 | 268 | elongation of very long chain fatty acids-like 6-like |
Identical Sequences to LMP012333 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41393157 | GenBank | AAH46901.1 | 268 | ELOVL family member 6, elongation of long chain fatty acids like [Danio rerio] |
| GI:41393157 | GenBank | AAI64614.1 | 268 | Elovl6l protein [Danio rerio] |
Related Sequences to LMP012333 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41393157 | EMBL | CDQ87920.1 | 269 | unnamed protein product [Oncorhynchus mykiss] |
| GI:41393157 | RefSeq | XP_003457542.1 | 268 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Oreochromis niloticus] |
| GI:41393157 | RefSeq | XP_004575343.1 | 268 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Maylandia zebra] |
| GI:41393157 | RefSeq | XP_005743595.1 | 268 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Pundamilia nyererei] |
| GI:41393157 | RefSeq | XP_005943067.1 | 268 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Haplochromis burtoni] |
| GI:41393157 | RefSeq | XP_006630910.1 | 269 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Lepisosteus oculatus] |