Gene/Proteome Database (LMPD)

LMPD ID
LMP012348
Gene ID
9370
Species
Homo sapiens (Human)
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
ADIPOQ
Synonyms
ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1;
Chromosome
3
Map Location
3q27
Summary
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]
Orthologs
View orthologs and multiple alignments for ADIPOQ

Proteins

adiponectin precursor
Refseq ID NP_001171271
Protein GI 295317372
UniProt ID Q15848
mRNA ID NM_001177800
Length 244
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
adiponectin precursor
Refseq ID NP_004788
Protein GI 4757760
UniProt ID Q15848
mRNA ID NM_004797
Length 244
Protein sequence is identical to GI:295317372 (mRNA isoform)
sig_peptide: 1..14 calculated_mol_wt: 1450 peptide sequence: MLLLGAVLLLLALP mat_peptide: 15..244 product: adiponectin calculated_mol_wt: 24982 peptide sequence: GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN sig_peptide: 1..14 calculated_mol_wt: 1450 peptide sequence: MLLLGAVLLLLALP mat_peptide: 15..244 product: adiponectin calculated_mol_wt: 24982 peptide sequence: GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Gene Information

Entrez Gene ID
9370
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
ADIPOQ
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IDA:BHF-UCL C cell surface
GO:0005581 IEA:UniProtKB-KW C collagen trimer
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 IDA:UniProtKB C extracellular space
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005125 NAS:BHF-UCL F cytokine activity
GO:0005179 IDA:BHF-UCL F hormone activity
GO:0042802 TAS:BHF-UCL F identical protein binding
GO:0042803 IPI:BHF-UCL F protein homodimerization activity
GO:0005102 ISS:UniProtKB F receptor binding
GO:0033691 IDA:UniProtKB F sialic acid binding
GO:0033211 IEA:Ensembl P adiponectin-activated signaling pathway
GO:0050873 ISS:UniProtKB P brown fat cell differentiation
GO:0071320 IEA:Ensembl P cellular response to cAMP
GO:0035690 ISS:UniProtKB P cellular response to drug
GO:0071872 IEA:Ensembl P cellular response to epinephrine stimulus
GO:0032869 ISS:UniProtKB P cellular response to insulin stimulus
GO:0007623 IEA:Ensembl P circadian rhythm
GO:0070994 ISS:UniProtKB P detection of oxidative stress
GO:0006635 ISS:UniProtKB P fatty acid beta-oxidation
GO:0019395 ISS:UniProtKB P fatty acid oxidation
GO:0006091 TAS:ProtInc P generation of precursor metabolites and energy
GO:0042593 ISS:UniProtKB P glucose homeostasis
GO:0006006 ISS:UniProtKB P glucose metabolic process
GO:0034383 IDA:BHF-UCL P low-density lipoprotein particle clearance
GO:0051899 IEA:Ensembl P membrane depolarization
GO:0060081 IEA:Ensembl P membrane hyperpolarization
GO:0045776 IDA:UniProtKB P negative regulation of blood pressure
GO:0030336 ISS:UniProtKB P negative regulation of cell migration
GO:2000279 IDA:UniProtKB P negative regulation of DNA biosynthetic process
GO:0070373 IDA:UniProtKB P negative regulation of ERK1 and ERK2 cascade
GO:0045599 IDA:BHF-UCL P negative regulation of fat cell differentiation
GO:0045721 ISS:BHF-UCL P negative regulation of gluconeogenesis
GO:0030853 IDA:BHF-UCL P negative regulation of granulocyte differentiation
GO:0034115 IDA:BHF-UCL P negative regulation of heterotypic cell-cell adhesion
GO:0046888 IEA:Ensembl P negative regulation of hormone secretion
GO:0043124 IDA:BHF-UCL P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050728 ISS:UniProtKB P negative regulation of inflammatory response
GO:0090317 IDA:UniProtKB P negative regulation of intracellular protein transport
GO:0045715 IDA:BHF-UCL P negative regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0010745 IDA:BHF-UCL P negative regulation of macrophage derived foam cell differentiation
GO:0045650 IDA:BHF-UCL P negative regulation of macrophage differentiation
GO:0043407 ISS:UniProtKB P negative regulation of MAP kinase activity
GO:2000590 ISS:UniProtKB P negative regulation of metanephric mesenchymal cell migration
GO:0050765 IDA:BHF-UCL P negative regulation of phagocytosis
GO:2000584 ISS:UniProtKB P negative regulation of platelet-derived growth factor receptor-alpha signaling pathway
GO:0010642 IDA:UniProtKB P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:0031953 IDA:UniProtKB P negative regulation of protein autophosphorylation
GO:1900121 IDA:UniProtKB P negative regulation of receptor binding
GO:0014912 IDA:UniProtKB P negative regulation of smooth muscle cell migration
GO:0048662 IDA:UniProtKB P negative regulation of smooth muscle cell proliferation
GO:0050805 IDA:UniProtKB P negative regulation of synaptic transmission
GO:0045892 IDA:UniProtKB P negative regulation of transcription, DNA-templated
GO:0010804 IDA:BHF-UCL P negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0032720 IDA:BHF-UCL P negative regulation of tumor necrosis factor production
GO:0045777 IEA:Ensembl P positive regulation of blood pressure
GO:2000481 IDA:UniProtKB P positive regulation of cAMP-dependent protein kinase activity
GO:0032270 IDA:BHF-UCL P positive regulation of cellular protein metabolic process
GO:0010875 IDA:BHF-UCL P positive regulation of cholesterol efflux
GO:0045923 ISS:BHF-UCL P positive regulation of fatty acid metabolic process
GO:0046326 ISS:BHF-UCL P positive regulation of glucose import
GO:2000467 ISS:UniProtKB P positive regulation of glycogen (starch) synthase activity
GO:0043123 ISS:UniProtKB P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032757 IDA:UniProtKB P positive regulation of interleukin-8 production
GO:2000478 ISS:UniProtKB P positive regulation of metanephric glomerular visceral epithelial cell development
GO:0071639 IDA:UniProtKB P positive regulation of monocyte chemotactic protein-1 production
GO:0033034 IDA:BHF-UCL P positive regulation of myeloid cell apoptotic process
GO:0050731 IEA:Ensembl P positive regulation of peptidyl-tyrosine phosphorylation
GO:0010739 IDA:BHF-UCL P positive regulation of protein kinase A signaling
GO:0001934 IDA:UniProtKB P positive regulation of protein phosphorylation
GO:2000534 IDA:UniProtKB P positive regulation of renal albumin absorption
GO:0009967 ISS:BHF-UCL P positive regulation of signal transduction
GO:0070208 IEA:Ensembl P protein heterotrimerization
GO:0051260 ISS:UniProtKB P protein homooligomerization
GO:0072659 IDA:UniProtKB P protein localization to plasma membrane
GO:0010906 IDA:UniProtKB P regulation of glucose metabolic process
GO:0014823 IEA:Ensembl P response to activity
GO:0045471 IEA:Ensembl P response to ethanol
GO:0051384 IEA:Ensembl P response to glucocorticoid
GO:0009749 ISS:BHF-UCL P response to glucose
GO:0001666 IEA:Ensembl P response to hypoxia
GO:0070543 IEA:Ensembl P response to linoleic acid
GO:0007584 IEA:Ensembl P response to nutrient
GO:0009744 IEA:Ensembl P response to sucrose
GO:0034612 IDA:BHF-UCL P response to tumor necrosis factor

KEGG Pathway Links

KEGG Pathway ID Description
hsa04920 Adipocytokine signaling pathway
ko04920 Adipocytokine signaling pathway
hsa04152 AMPK signaling pathway
ko04152 AMPK signaling pathway
hsa04932 Non-alcoholic fatty liver disease (NAFLD)
ko04932 Non-alcoholic fatty liver disease (NAFLD)
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway
hsa04930 Type II diabetes mellitus
ko04930 Type II diabetes mellitus

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_111045 Developmental Biology
REACT_27161 Transcriptional regulation of white adipocyte differentiation

Domain Information

InterPro Annotations

Accession Description
IPR028572 Adiponectin
IPR008160 Collagen triple helix repeat
IPR001073 Complement C1q protein
IPR008983 Tumour necrosis factor-like domain

UniProt Annotations

Entry Information

Gene Name
adiponectin, C1Q and collagen domain containing
UniProt ID
Q15848
Species
Human

Comments

Comment Type Description
Disease Adiponectin deficiency (ADPND) [MIM:612556]: A condition that results in very low concentrations of plasma adiponectin Note=The disease is caused by mutations affecting the gene represented in this entry.
Disease Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
Domain The C1q domain is commonly called the globular domain.
Function Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW
Miscellaneous HMW-complex blood contents are higher in females than in males, are increased in males by castration and decreased again upon subsequent testosterone treatment, which blocks HMW- complex secretion (By similarity). In type 2 diabetic patients, both the ratios of HMW to total adiponectin and the degree of adiponectin glycosylation are significantly decreased as compared with healthy controls
Miscellaneous Variants Arg-84 and Ser-90 show impaired formation of HMW complexes whereas variants Cys-112 and Thr-164 show impaired secretion of adiponectin in any form.
Pharmaceutical Adiponectin might be used in the treatment of diabetes type 2 and insulin resistance.
Polymorphism Genetic variations in ADIPOQ influence the variance in adiponectin serum levels and define the adiponectin serum levels quantitative trait locus 1 (ADIPQTL1) [MIM:612556].
Ptm HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin- sensitizing activity of adiponectin in hepatocytes (By similarity)
Ptm Hydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting
Ptm O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation
Similarity Contains 1 C1q domain. {ECO:0000255|PROSITE- ProRule:PRU00368}.
Similarity Contains 1 collagen-like domain
Subcellular Location Secreted.
Subunit Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely additionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex) (By similarity)
Tissue Specificity Synthesized exclusively by adipocytes and secreted into plasma.
Web Resource Name=Wikipedia; Note=Adiponectin entry; URL="http://en.wikipedia.org/wiki/Adiponectin";

Identical and Related Proteins

Unique RefSeq proteins for LMP012348 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
295317372 RefSeq NP_001171271 244 adiponectin precursor

Identical Sequences to LMP012348 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012348 proteins

Reference Database Accession Length Protein Name