Gene/Proteome Database (LMPD)
LMPD ID
LMP012348
Gene ID
Species
Homo sapiens (Human)
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Synonyms
ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1;
Chromosome
3
Map Location
3q27
Summary
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]
Orthologs
Proteins
| adiponectin precursor | |
|---|---|
| Refseq ID | NP_001171271 |
| Protein GI | 295317372 |
| UniProt ID | Q15848 |
| mRNA ID | NM_001177800 |
| Length | 244 |
| MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN | |
| adiponectin precursor | |
|---|---|
| Refseq ID | NP_004788 |
| Protein GI | 4757760 |
| UniProt ID | Q15848 |
| mRNA ID | NM_004797 |
| Length | 244 |
| Protein sequence is identical to GI:295317372 (mRNA isoform) | |
| sig_peptide: 1..14 calculated_mol_wt: 1450 peptide sequence: MLLLGAVLLLLALP mat_peptide: 15..244 product: adiponectin calculated_mol_wt: 24982 peptide sequence: GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN sig_peptide: 1..14 calculated_mol_wt: 1450 peptide sequence: MLLLGAVLLLLALP mat_peptide: 15..244 product: adiponectin calculated_mol_wt: 24982 peptide sequence: GHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN | |
Gene Information
Entrez Gene ID
Gene Name
adiponectin, C1Q and collagen domain containing
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009986 | IDA:BHF-UCL | C | cell surface |
| GO:0005581 | IEA:UniProtKB-KW | C | collagen trimer |
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0005615 | IDA:UniProtKB | C | extracellular space |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0005125 | NAS:BHF-UCL | F | cytokine activity |
| GO:0005179 | IDA:BHF-UCL | F | hormone activity |
| GO:0042802 | TAS:BHF-UCL | F | identical protein binding |
| GO:0042803 | IPI:BHF-UCL | F | protein homodimerization activity |
| GO:0005102 | ISS:UniProtKB | F | receptor binding |
| GO:0033691 | IDA:UniProtKB | F | sialic acid binding |
| GO:0033211 | IEA:Ensembl | P | adiponectin-activated signaling pathway |
| GO:0050873 | ISS:UniProtKB | P | brown fat cell differentiation |
| GO:0071320 | IEA:Ensembl | P | cellular response to cAMP |
| GO:0035690 | ISS:UniProtKB | P | cellular response to drug |
| GO:0071872 | IEA:Ensembl | P | cellular response to epinephrine stimulus |
| GO:0032869 | ISS:UniProtKB | P | cellular response to insulin stimulus |
| GO:0007623 | IEA:Ensembl | P | circadian rhythm |
| GO:0070994 | ISS:UniProtKB | P | detection of oxidative stress |
| GO:0006635 | ISS:UniProtKB | P | fatty acid beta-oxidation |
| GO:0019395 | ISS:UniProtKB | P | fatty acid oxidation |
| GO:0006091 | TAS:ProtInc | P | generation of precursor metabolites and energy |
| GO:0042593 | ISS:UniProtKB | P | glucose homeostasis |
| GO:0006006 | ISS:UniProtKB | P | glucose metabolic process |
| GO:0034383 | IDA:BHF-UCL | P | low-density lipoprotein particle clearance |
| GO:0051899 | IEA:Ensembl | P | membrane depolarization |
| GO:0060081 | IEA:Ensembl | P | membrane hyperpolarization |
| GO:2000279 | IDA:UniProtKB | P | negative regulation of DNA biosynthetic process |
| GO:0070373 | IDA:UniProtKB | P | negative regulation of ERK1 and ERK2 cascade |
| GO:0043124 | IDA:BHF-UCL | P | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0043407 | ISS:UniProtKB | P | negative regulation of MAP kinase activity |
| GO:0045776 | IDA:UniProtKB | P | negative regulation of blood pressure |
| GO:0030336 | ISS:UniProtKB | P | negative regulation of cell migration |
| GO:0045599 | IDA:BHF-UCL | P | negative regulation of fat cell differentiation |
| GO:0045721 | ISS:BHF-UCL | P | negative regulation of gluconeogenesis |
| GO:0030853 | IDA:BHF-UCL | P | negative regulation of granulocyte differentiation |
| GO:0034115 | IDA:BHF-UCL | P | negative regulation of heterotypic cell-cell adhesion |
| GO:0046888 | IEA:Ensembl | P | negative regulation of hormone secretion |
| GO:0050728 | ISS:UniProtKB | P | negative regulation of inflammatory response |
| GO:0090317 | IDA:UniProtKB | P | negative regulation of intracellular protein transport |
| GO:0045715 | IDA:BHF-UCL | P | negative regulation of low-density lipoprotein particle receptor biosynthetic process |
| GO:0010745 | IDA:BHF-UCL | P | negative regulation of macrophage derived foam cell differentiation |
| GO:0045650 | IDA:BHF-UCL | P | negative regulation of macrophage differentiation |
| GO:2000590 | ISS:UniProtKB | P | negative regulation of metanephric mesenchymal cell migration |
| GO:0050765 | IDA:BHF-UCL | P | negative regulation of phagocytosis |
| GO:0010642 | IDA:UniProtKB | P | negative regulation of platelet-derived growth factor receptor signaling pathway |
| GO:2000584 | ISS:UniProtKB | P | negative regulation of platelet-derived growth factor receptor-alpha signaling pathway |
| GO:0031953 | IDA:UniProtKB | P | negative regulation of protein autophosphorylation |
| GO:1900121 | IDA:UniProtKB | P | negative regulation of receptor binding |
| GO:0014912 | IDA:UniProtKB | P | negative regulation of smooth muscle cell migration |
| GO:0048662 | IDA:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
| GO:0050805 | IDA:UniProtKB | P | negative regulation of synaptic transmission |
| GO:0045892 | IDA:UniProtKB | P | negative regulation of transcription, DNA-templated |
| GO:0032720 | IDA:BHF-UCL | P | negative regulation of tumor necrosis factor production |
| GO:0010804 | IDA:BHF-UCL | P | negative regulation of tumor necrosis factor-mediated signaling pathway |
| GO:0043123 | ISS:UniProtKB | P | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0045777 | IEA:Ensembl | P | positive regulation of blood pressure |
| GO:2000481 | IDA:UniProtKB | P | positive regulation of cAMP-dependent protein kinase activity |
| GO:0032270 | IDA:BHF-UCL | P | positive regulation of cellular protein metabolic process |
| GO:0010875 | IDA:BHF-UCL | P | positive regulation of cholesterol efflux |
| GO:0045923 | ISS:BHF-UCL | P | positive regulation of fatty acid metabolic process |
| GO:0046326 | ISS:BHF-UCL | P | positive regulation of glucose import |
| GO:2000467 | ISS:UniProtKB | P | positive regulation of glycogen (starch) synthase activity |
| GO:0032757 | IDA:UniProtKB | P | positive regulation of interleukin-8 production |
| GO:2000478 | ISS:UniProtKB | P | positive regulation of metanephric glomerular visceral epithelial cell development |
| GO:0071639 | IDA:UniProtKB | P | positive regulation of monocyte chemotactic protein-1 production |
| GO:0033034 | IDA:BHF-UCL | P | positive regulation of myeloid cell apoptotic process |
| GO:0050731 | IEA:Ensembl | P | positive regulation of peptidyl-tyrosine phosphorylation |
| GO:0010739 | IDA:BHF-UCL | P | positive regulation of protein kinase A signaling |
| GO:0001934 | IDA:UniProtKB | P | positive regulation of protein phosphorylation |
| GO:2000534 | IDA:UniProtKB | P | positive regulation of renal albumin absorption |
| GO:0009967 | ISS:BHF-UCL | P | positive regulation of signal transduction |
| GO:0070208 | IEA:Ensembl | P | protein heterotrimerization |
| GO:0051260 | ISS:UniProtKB | P | protein homooligomerization |
| GO:0072659 | IDA:UniProtKB | P | protein localization to plasma membrane |
| GO:0010906 | IDA:UniProtKB | P | regulation of glucose metabolic process |
| GO:0014823 | IEA:Ensembl | P | response to activity |
| GO:0045471 | IEA:Ensembl | P | response to ethanol |
| GO:0051384 | IEA:Ensembl | P | response to glucocorticoid |
| GO:0009749 | ISS:BHF-UCL | P | response to glucose |
| GO:0001666 | IEA:Ensembl | P | response to hypoxia |
| GO:0070543 | IEA:Ensembl | P | response to linoleic acid |
| GO:0007584 | IEA:Ensembl | P | response to nutrient |
| GO:0009744 | IEA:Ensembl | P | response to sucrose |
| GO:0034612 | IDA:BHF-UCL | P | response to tumor necrosis factor |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04152 | AMPK signaling pathway |
| ko04152 | AMPK signaling pathway |
| hsa04920 | Adipocytokine signaling pathway |
| ko04920 | Adipocytokine signaling pathway |
| hsa04932 | Non-alcoholic fatty liver disease (NAFLD) |
| ko04932 | Non-alcoholic fatty liver disease (NAFLD) |
| hsa03320 | PPAR signaling pathway |
| ko03320 | PPAR signaling pathway |
| hsa04930 | Type II diabetes mellitus |
| ko04930 | Type II diabetes mellitus |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_111045 | Developmental Biology |
| REACT_27161 | Transcriptional regulation of white adipocyte differentiation |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Disease | Adiponectin deficiency (ADPND) [MIM:612556]: A condition that results in very low concentrations of plasma adiponectin Note=The disease is caused by mutations affecting the gene represented in this entry. |
| Disease | Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry. |
| Domain | The C1q domain is commonly called the globular domain. |
| Function | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW |
| Miscellaneous | HMW-complex blood contents are higher in females than in males, are increased in males by castration and decreased again upon subsequent testosterone treatment, which blocks HMW- complex secretion (By similarity). In type 2 diabetic patients, both the ratios of HMW to total adiponectin and the degree of adiponectin glycosylation are significantly decreased as compared with healthy controls |
| Miscellaneous | Variants Arg-84 and Ser-90 show impaired formation of HMW complexes whereas variants Cys-112 and Thr-164 show impaired secretion of adiponectin in any form. |
| Pharmaceutical | Adiponectin might be used in the treatment of diabetes type 2 and insulin resistance. |
| Polymorphism | Genetic variations in ADIPOQ influence the variance in adiponectin serum levels and define the adiponectin serum levels quantitative trait locus 1 (ADIPQTL1) [MIM:612556]. |
| Ptm | HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin- sensitizing activity of adiponectin in hepatocytes (By similarity) |
| Ptm | Hydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting |
| Ptm | O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation |
| Similarity | Contains 1 C1q domain. {ECO:0000255|PROSITE- ProRule:PRU00368}. |
| Similarity | Contains 1 collagen-like domain |
| Subcellular Location | Secreted. |
| Subunit | Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely additionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex) (By similarity) |
| Tissue Specificity | Synthesized exclusively by adipocytes and secreted into plasma. |
| Web Resource | Name=Wikipedia; Note=Adiponectin entry; URL="http://en.wikipedia.org/wiki/Adiponectin"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP012348 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 295317372 | RefSeq | NP_001171271 | 244 | adiponectin precursor |
Identical Sequences to LMP012348 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP012348 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|