Gene/Proteome Database (LMPD)
LMPD ID
LMP012370
Gene ID
Species
Homo sapiens (Human)
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Synonyms
ADMP; SSSPTB; C3orf57;
Chromosome
3
Map Location
3q26.1
Summary
Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
Orthologs
Proteins
| serine palmitoyltransferase small subunit B | |
|---|---|
| Refseq ID | NP_001035189 |
| Protein GI | 93141042 |
| UniProt ID | Q8NFR3 |
| mRNA ID | NM_001040100 |
| Length | 76 |
| MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit B
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017059 | IDA:UniProtKB | C | serine C-palmitoyltransferase complex |
| GO:0030148 | TAS:UniProtKB | P | sphingolipid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clear preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference. May play a role in signal transduction |
| Induction | Expression is suppressed by androgens in the androgen- sensitive LNCaP cell line |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Similarity | Belongs to the SPTSS family. SPTSSB subfamily |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein |
| Subunit | Interacts with SPTLC1; the interaction is direct. Component of the serine palmitoyltransferase (SPT) complex, composed of SPTLC1, either SPTLC2 or SPTLC3, and either SPTSSA or SPTSSB |
| Tissue Specificity | Expression is seen predominantly in the prostate epithelium with weaker expression in the fibroblasts and endothelial cells |
Identical and Related Proteins
Unique RefSeq proteins for LMP012370 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 93141042 | RefSeq | NP_001035189 | 76 | serine palmitoyltransferase small subunit B |
Identical Sequences to LMP012370 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP012370 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|