Gene/Proteome Database (LMPD)

LMPD ID
LMP012371
Gene ID
Species
Homo sapiens (Human)
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Synonyms
SSSPTA; C14orf147;
Chromosome
14
Map Location
14q13.1
Summary
Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTA is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
Orthologs

Proteins

serine palmitoyltransferase small subunit A
Refseq ID NP_612145
Protein GI 115527094
UniProt ID Q969W0
mRNA ID NM_138288
Length 71
MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ

Gene Information

Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0017059 IDA:UniProtKB C serine C-palmitoyltransferase complex
GO:0030148 TAS:UniProtKB P sphingolipid biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-12 ceramide de novo biosynthesis
PWY-7277 sphingolipid biosynthesis (mammals)

Domain Information

InterPro Annotations

Accession Description
IPR024512 Small subunit of serine palmitoyltransferase-like

UniProt Annotations

Entry Information

Gene Name
serine palmitoyltransferase, small subunit A
UniProt ID
Species
Human

Comments

Comment Type Description
Caution It is uncertain whether Met-1 or Met-4 is the initiator
Function Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2- SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16- CoA as substrates, with a slight preference for C14-CoA
Pathway Lipid metabolism; sphingolipid metabolism.
Sequence Caution Sequence=AAH16805.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH16808.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH21701.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH68480.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=BAG37801.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ;
Similarity Belongs to the SPTSS family. SPTSSA subfamily
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein
Subunit Interacts with SPTLC1; the interaction is direct. Component of the serine palmitoyltransferase (SPT) complex, composed of SPTLC1, either SPTLC2 or SPTLC3, and either SPTSSA or SPTSSB

Identical and Related Proteins

Unique RefSeq proteins for LMP012371 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
115527094 RefSeq NP_612145 71 serine palmitoyltransferase small subunit A

Identical Sequences to LMP012371 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012371 proteins

Reference Database Accession Length Protein Name