Gene/Proteome Database (LMPD)

LMPD ID
LMP012391
Gene ID
24192
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Symbol
Akr1b1
Synonyms
Alr; Aldr1; ALDRED; Akr1b3; Akr1b4; ALR-P-I; RATALDRED;
Alternate Names
aldose reductase; AR; aldo-keto reductase family 1, member B4 (aldose reductase); Aldehyde reductase 1 (low Km aldose reductase) (5.8 kb PstI fragment, probably the functional gene);
Chromosome
4
Map Location
4q22
EC Number
1.1.1.21
Summary
regulates NF-kappa B mediated mitogenic signaling; may play a role in the polyol pathway [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Akr1b1

Proteins

aldose reductase
Refseq ID NP_036630
Protein GI 6978491
UniProt ID P07943
mRNA ID NM_012498
Length 316
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV

Gene Information

Entrez Gene ID
24192
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Symbol
Akr1b1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043220 IDA:RGD C Schmidt-Lanterman incisure
GO:0097454 IDA:RGD C Schwann cell microvillus
GO:0032838 IDA:RGD C cell projection cytoplasm
GO:0005829 IDA:RGD C cytosol
GO:0005615 IDA:RGD C extracellular space
GO:0042629 IDA:RGD C mast cell granule
GO:0033010 IDA:RGD C paranodal junction
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0004032 IDA:RGD F alditol:NADP+ 1-oxidoreductase activity
GO:0070301 IDA:RGD P cellular response to hydrogen peroxide
GO:0097238 IDA:RGD P cellular response to methylglyoxal
GO:1901653 IEP:RGD P cellular response to peptide
GO:0072061 IDA:RGD P inner medullary collecting duct development
GO:0060135 IEP:RGD P maternal process involved in female pregnancy
GO:0005996 IDA:RGD P monosaccharide metabolic process
GO:0018931 IDA:RGD P naphthalene metabolic process
GO:0042415 IDA:RGD P norepinephrine metabolic process
GO:0046427 IMP:RGD P positive regulation of JAK-STAT cascade
GO:0048661 IMP:RGD P positive regulation of smooth muscle cell proliferation
GO:0010033 IDA:RGD P response to organic substance
GO:0097066 IEP:RGD P response to thyroid hormone
GO:0009414 IDA:RGD P response to water deprivation
GO:0006061 IMP:RGD P sorbitol biosynthetic process
GO:0031098 IMP:RGD P stress-activated protein kinase signaling cascade
GO:0001894 IMP:RGD P tissue homeostasis

KEGG Pathway Links

KEGG Pathway ID Description
ko00051 Fructose and mannose metabolism
rno00051 Fructose and mannose metabolism
ko00052 Galactose metabolism
rno00052 Galactose metabolism
ko00561 Glycerolipid metabolism
rno00561 Glycerolipid metabolism
rno01100 Metabolic pathways
ko00040 Pentose and glucuronate interconversions
rno00040 Pentose and glucuronate interconversions

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953937 Metabolism of steroid hormones and vitamin D
5953939 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Protein Entry
ALDR_RAT
UniProt ID
P07943
Species
Rat

Comments

Comment Type Description
Catalytic Activity Alditol + NAD(P)(+) = aldose + NAD(P)H.
Function Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
Similarity Belongs to the aldo/keto reductase family
Subcellular Location Cytoplasm.
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP012391 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978491 RefSeq NP_036630 316 aldose reductase

Identical Sequences to LMP012391 proteins

Reference Database Accession Length Protein Name
GI:6978491 GenBank AAE45663.1 316 Sequence 4 from patent US 6087140
GI:6978491 GenBank AAE83465.1 316 Sequence 4 from patent US 6303352
GI:6978491 GenBank AAH62034.1 316 Aldo-keto reductase family 1, member B1 (aldose reductase) [Rattus norvegicus]
GI:6978491 GenBank EDM15300.1 316 rCG27858, isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP012391 proteins

Reference Database Accession Length Protein Name
GI:6978491 GenBank AAE83465.1 316 Sequence 4 from patent US 6303352
GI:6978491 GenBank AAH62034.1 316 Aldo-keto reductase family 1, member B1 (aldose reductase) [Rattus norvegicus]
GI:6978491 GenBank EDM15300.1 316 rCG27858, isoform CRA_b [Rattus norvegicus]