Gene/Proteome Database (LMPD)
LMPD ID
LMP012429
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
retinoic acid receptor, beta
Gene Symbol
Alternate Names
retinoic acid receptor beta;
Chromosome
15
Map Location
chromosome:15
Summary
beta form of the retinoic acid receptor [RGD, Feb 2006]
Orthologs
Proteins
| retinoic acid receptor beta | |
|---|---|
| Refseq ID | NP_113717 |
| Protein GI | 401461796 |
| UniProt ID | D3ZFD9 |
| mRNA ID | NM_031529 |
| Length | 448 |
| MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACLSGFTQAEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPNSSGNTAEHSPSVSPSSVETSGVSQSPLLQ | |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor, beta
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IDA:RGD | C | nucleus |
| GO:0008144 | IDA:RGD | F | drug binding |
| GO:0032403 | IPI:RGD | F | protein complex binding |
| GO:0003708 | IDA:RGD | F | retinoic acid receptor activity |
| GO:0046965 | IPI:RGD | F | retinoid X receptor binding |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0045666 | IDA:RGD | P | positive regulation of neuron differentiation |
| GO:0031641 | IDA:RGD | P | regulation of myelination |
| GO:0048384 | IDA:RGD | P | retinoic acid receptor signaling pathway |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko05223 | Non-small cell lung cancer |
| rno05223 | Non-small cell lung cancer |
| rno05200 | Pathways in cancer |
| ko05222 | Small cell lung cancer |
| rno05222 | Small cell lung cancer |
REACTOME Pathway Links
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the nuclear hormone receptor family |
| Similarity | Contains nuclear receptor DNA-binding domain |
Identical and Related Proteins
Unique RefSeq proteins for LMP012429 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 401461796 | RefSeq | NP_113717 | 448 | retinoic acid receptor beta |
Identical Sequences to LMP012429 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:401461796 | GenBank | EDL94092.1 | 448 | retinoic acid receptor, beta [Rattus norvegicus] |
Related Sequences to LMP012429 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:401461796 | GenBank | AAH76597.1 | 448 | Retinoic acid receptor, beta [Mus musculus] |
| GI:401461796 | GenBank | EDL94092.1 | 448 | retinoic acid receptor, beta [Rattus norvegicus] |
| GI:401461796 | RefSeq | XP_003499232.1 | 448 | PREDICTED: retinoic acid receptor beta isoform X3 [Cricetulus griseus] |