Gene/Proteome Database (LMPD)
LMPD ID
LMP012429
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
retinoic acid receptor, beta
Gene Symbol
Alternate Names
retinoic acid receptor beta;
Chromosome
15
Map Location
chromosome:15
Summary
beta form of the retinoic acid receptor [RGD, Feb 2006]
Orthologs
Proteins
retinoic acid receptor beta | |
---|---|
Refseq ID | NP_113717 |
Protein GI | 401461796 |
UniProt ID | D3ZFD9 |
mRNA ID | NM_031529 |
Length | 448 |
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACLSGFTQAEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPNSSGNTAEHSPSVSPSSVETSGVSQSPLLQ |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor, beta
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IDA:RGD | C | nucleus |
GO:0008144 | IDA:RGD | F | drug binding |
GO:0032403 | IPI:RGD | F | protein complex binding |
GO:0003708 | IDA:RGD | F | retinoic acid receptor activity |
GO:0046965 | IPI:RGD | F | retinoid X receptor binding |
GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0045666 | IDA:RGD | P | positive regulation of neuron differentiation |
GO:0031641 | IDA:RGD | P | regulation of myelination |
GO:0048384 | IDA:RGD | P | retinoic acid receptor signaling pathway |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko05223 | Non-small cell lung cancer |
rno05223 | Non-small cell lung cancer |
rno05200 | Pathways in cancer |
ko05222 | Small cell lung cancer |
rno05222 | Small cell lung cancer |
REACTOME Pathway Links
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Similarity | Belongs to the nuclear hormone receptor family |
Similarity | Contains nuclear receptor DNA-binding domain |
Identical and Related Proteins
Unique RefSeq proteins for LMP012429 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
401461796 | RefSeq | NP_113717 | 448 | retinoic acid receptor beta |
Identical Sequences to LMP012429 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:401461796 | GenBank | EDL94092.1 | 448 | retinoic acid receptor, beta [Rattus norvegicus] |
Related Sequences to LMP012429 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:401461796 | GenBank | AAH76597.1 | 448 | Retinoic acid receptor, beta [Mus musculus] |
GI:401461796 | GenBank | EDL94092.1 | 448 | retinoic acid receptor, beta [Rattus norvegicus] |
GI:401461796 | RefSeq | XP_003499232.1 | 448 | PREDICTED: retinoic acid receptor beta isoform X3 [Cricetulus griseus] |