Gene/Proteome Database (LMPD)

LMPD ID
LMP012437
Gene ID
24803
Species
Rattus norvegicus (Rat)
Gene Name
vesicle-associated membrane protein 2
Gene Symbol
Vamp2
Synonyms
SYB; Syb2; RATVAMPB; RATVAMPIR;
Alternate Names
vesicle-associated membrane protein 2; VAMP-2; synaptobrevin-2; Vesicle-associated membrane protein (synaptobrevin 2); Synaptobrevin 2 (vesicle-associated membrane protein VAMP-2);
Chromosome
10
Map Location
10q24
Summary
plays a role in membrane fusion in neuronal exocytosis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Vamp2

Proteins

vesicle-associated membrane protein 2
Refseq ID NP_036795
Protein GI 6981614
UniProt ID P63045
mRNA ID NM_012663
Length 116
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Gene Information

Entrez Gene ID
24803
Gene Name
vesicle-associated membrane protein 2
Gene Symbol
Vamp2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031201 IDA:ParkinsonsUK-UCL C SNARE complex
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0043229 IDA:RGD C intracellular organelle
GO:0043005 IDA:RGD C neuron projection
GO:0044306 IDA:ParkinsonsUK-UCL C neuron projection terminus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0030141 IDA:UniProtKB C secretory granule
GO:0008021 IDA:ParkinsonsUK-UCL C synaptic vesicle
GO:0030672 NAS:ParkinsonsUK-UCL C synaptic vesicle membrane
GO:0070044 IDA:MGI C synaptobrevin 2-SNAP-25-syntaxin-1a complex
GO:0070032 IDA:MGI C synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
GO:0070033 IDA:RGD C synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
GO:0005802 IEA:Ensembl C trans-Golgi network
GO:0042589 IEA:Ensembl C zymogen granule membrane
GO:0000149 IDA:MGI F SNARE binding
GO:0048306 IPI:ParkinsonsUK-UCL F calcium-dependent protein binding
GO:0042802 IPI:IntAct F identical protein binding
GO:0017022 IPI:RGD F myosin binding
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0008022 IPI:RGD F protein C-terminus binding
GO:0032403 IPI:RGD F protein complex binding
GO:0017075 IDA:MGI F syntaxin-1 binding
GO:0043001 IEA:Ensembl P Golgi to plasma membrane protein transport
GO:0017156 IEA:Ensembl P calcium ion-dependent exocytosis
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0060291 IEA:Ensembl P long-term synaptic potentiation
GO:0061025 IEA:Ensembl P membrane fusion
GO:0090316 IEA:Ensembl P positive regulation of intracellular protein transport
GO:0006461 IDA:RGD P protein complex assembly
GO:0015031 IMP:RGD P protein transport
GO:0017157 TAS:UniProtKB P regulation of exocytosis
GO:0009749 IDA:UniProtKB P response to glucose
GO:0016079 IEA:Ensembl P synaptic vesicle exocytosis
GO:0016192 IMP:RGD P vesicle-mediated transport

KEGG Pathway Links

KEGG Pathway ID Description
rno04911 Insulin secretion
ko04130 SNARE interactions in vesicular transport
rno04130 SNARE interactions in vesicular transport
ko04970 Salivary secretion
rno04970 Salivary secretion
ko04721 Synaptic vesicle cycle
rno04721 Synaptic vesicle cycle
ko04962 Vasopressin-regulated water reabsorption
rno04962 Vasopressin-regulated water reabsorption

REACTOME Pathway Links

REACTOME Pathway ID Description
5954090 Acetylcholine Neurotransmitter Release Cycle
5954103 Clathrin derived vesicle budding
5954111 GABA synthesis, release, reuptake and degradation
5953278 Glutamate Neurotransmitter Release Cycle
5954251 Golgi Associated Vesicle Biogenesis
5953611 Integration of energy metabolism
5954284 Lysosome Vesicle Biogenesis
5953916 Membrane Trafficking
5953250 Metabolism
5953277 Neuronal System
5953279 Neurotransmitter Release Cycle
5954116 Norepinephrine Neurotransmitter Release Cycle
5953749 Regulation of insulin secretion
5954455 Translocation of GLUT4 to the plasma membrane
5953276 Transmission across Chemical Synapses
5954104 trans-Golgi Network Vesicle Budding

Domain Information

InterPro Annotations

Accession Description
IPR001388 Synaptobrevin
IPR016444 Synaptobrevin/Vesicle-associated membrane protein

UniProt Annotations

Entry Information

Gene Name
vesicle-associated membrane protein 2
Protein Entry
VAMP2_RAT
UniProt ID
P63045
Species
Rat

Comments

Comment Type Description
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane
Interaction Self; NbExp=2; IntAct=EBI-520880, EBI-520880; D4A229:Prkd3; NbExp=2; IntAct=EBI-520880, EBI-1255458; P32851:Stx1a; NbExp=5; IntAct=EBI-520880, EBI-539720;
Similarity Belongs to the synaptobrevin family
Similarity Contains 1 v-SNARE coiled-coil homology domain
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Note=Neuronal synaptic vesicles.
Subunit Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with BVES and STX4. Interacts with VAPA and VAPB (By similarity)
Tissue Specificity Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord

Identical and Related Proteins

Unique RefSeq proteins for LMP012437 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981614 RefSeq NP_036795 116 vesicle-associated membrane protein 2

Identical Sequences to LMP012437 proteins

Reference Database Accession Length Protein Name
GI:6981614 RefSeq XP_004594820.1 116 PREDICTED: vesicle-associated membrane protein 2 [Ochotona princeps]
GI:6981614 RefSeq XP_005067632.1 116 PREDICTED: vesicle-associated membrane protein 2 [Mesocricetus auratus]
GI:6981614 RefSeq XP_005349860.1 116 PREDICTED: vesicle-associated membrane protein 2 [Microtus ochrogaster]
GI:6981614 RefSeq XP_008853980.1 116 PREDICTED: vesicle-associated membrane protein 2 [Nannospalax galili]

Related Sequences to LMP012437 proteins

Reference Database Accession Length Protein Name
GI:6981614 GenBank AAA42321.1 116 vesicle associated membrane protein VAMP-2 [Rattus norvegicus]
GI:6981614 GenBank AAB03463.1 116 VAMP-2 [Mus musculus]
GI:6981614 GenBank ACH14833.1 116 Sequence 9 from patent US 7399607