Gene/Proteome Database (LMPD)

LMPD ID
LMP012446
Gene ID
24890
Species
Rattus norvegicus (Rat)
Gene Name
estrogen receptor 1
Gene Symbol
Esr1
Synonyms
Esr; ER-alpha; RNESTROR;
Alternate Names
estrogen receptor; Er alpha; estradiol receptor; estrogen receptor protein; estrogen receptor 1 (alpha); estrogen receptor alpha variant delta 4; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha c-terminus splice variant 1-2;
Chromosome
1
Map Location
1q12
Summary
acts as a transcriptional activator when bound to estrogen; may play a role in myocardial regulation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Esr1

Proteins

estrogen receptor
Refseq ID NP_036821
Protein GI 6978815
UniProt ID P06211
mRNA ID NM_012689
Length 600
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAYEFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPPHVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI

Gene Information

Entrez Gene ID
24890
Gene Name
estrogen receptor 1
Gene Symbol
Esr1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0030315 IDA:RGD C T-tubule
GO:0005737 IDA:RGD C cytoplasm
GO:0005739 IDA:RGD C mitochondrion
GO:0043005 IDA:RGD C neuron projection
GO:0005634 IDA:UniProtKB C nucleus
GO:0043204 IDA:RGD C perikaryon
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0005886 IDA:RGD C plasma membrane
GO:0043234 IDA:RGD C protein complex
GO:0043195 IDA:RGD C terminal bouton
GO:0003677 IMP:RGD F DNA binding
GO:0003682 ISS:UniProtKB F chromatin binding
GO:0001046 IDA:RGD F core promoter sequence-specific DNA binding
GO:0019899 IPI:RGD F enzyme binding
GO:0030284 IDA:RGD F estrogen receptor activity
GO:0042562 IDA:RGD F hormone binding
GO:0032403 IDA:RGD F protein complex binding
GO:0003700 IEA:InterPro F sequence-specific DNA binding transcription factor activity
GO:0005496 IDA:UniProtKB F steroid binding
GO:0003707 IDA:RGD F steroid hormone receptor activity
GO:0031798 IPI:RGD F type 1 metabotropic glutamate receptor binding
GO:0008270 IEA:InterPro F zinc ion binding
GO:0060009 IEP:RGD P Sertoli cell development
GO:0060011 IMP:RGD P Sertoli cell proliferation
GO:1990375 IEP:RGD P baculum development
GO:0071392 IDA:UniProtKB P cellular response to estradiol stimulus
GO:0046697 IEP:RGD P decidualization
GO:0030518 IDA:UniProtKB P intracellular steroid hormone receptor signaling pathway
GO:0008584 IEP:RGD P male gonad development
GO:0043124 ISS:UniProtKB P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0046325 IDA:RGD P negative regulation of glucose import
GO:1901215 IDA:RGD P negative regulation of neuron death
GO:0043433 ISS:UniProtKB P negative regulation of sequence-specific DNA binding transcription factor activity
GO:0048662 IMP:RGD P negative regulation of smooth muscle cell proliferation
GO:0090209 IDA:RGD P negative regulation of triglyceride metabolic process
GO:0002076 IEP:RGD P osteoblast development
GO:0007200 IDA:UniProtKB P phospholipase C-activating G-protein coupled receptor signaling pathway
GO:0070374 IDA:RGD P positive regulation of ERK1 and ERK2 cascade
GO:0007204 IDA:UniProtKB P positive regulation of cytosolic calcium ion concentration
GO:0045742 IMP:RGD P positive regulation of epidermal growth factor receptor signaling pathway
GO:0045429 ISS:UniProtKB P positive regulation of nitric oxide biosynthetic process
GO:0051000 ISS:UniProtKB P positive regulation of nitric-oxide synthase activity
GO:0010863 IDA:UniProtKB P positive regulation of phospholipase C activity
GO:0051091 ISS:UniProtKB P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0045944 TAS:RGD P positive regulation of transcription from RNA polymerase II promoter
GO:0043523 IDA:RGD P regulation of neuron apoptotic process
GO:0032355 IEP:RGD P response to estradiol
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

KEGG Pathway Links

KEGG Pathway ID Description
ko04961 Endocrine and other factor-regulated calcium reabsorption
rno04961 Endocrine and other factor-regulated calcium reabsorption
ko04915 Estrogen signaling pathway
rno04915 Estrogen signaling pathway
ko04917 Prolactin signaling pathway
rno04917 Prolactin signaling pathway
ko05205 Proteoglycans in cancer
rno05205 Proteoglycans in cancer
rno04919 Thyroid hormone signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953330 Gene Expression
5953833 Generic Transcription Pathway
5954147 Nuclear Receptor transcription pathway
5954400 Nuclear signaling by ERBB4
5953381 Signal Transduction
5953540 Signaling by ERBB4

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001292 Oestrogen receptor
IPR024178 Oestrogen receptor/oestrogen-related receptor
IPR024736 Oestrogen-type nuclear receptor final C-terminal domain
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
estrogen receptor 1
Protein Entry
ESR1_RAT
UniProt ID
P06211
Species
Rat

Comments

Comment Type Description
Domain Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. The modulating domain, also known as A/B or AF-1 domain has a ligand- independent transactivation function. The C-terminus contains a ligand-dependent transactivation domain, also known as E/F or AF-2 domain which overlaps with the ligand binding domain. AF-1 and AF- 2 activate transcription independently and synergistically and act in a promoter- and cell-specific manner (By similarity)
Function Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA- binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF- kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA- binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity)
Miscellaneous In the absence of ligand, steroid hormone receptors are thought to be weakly associated with nuclear components; hormone binding greatly increases receptor affinity. The hormone- receptor complex appears to recognize discrete DNA sequences upstream of transcriptional start sites.
Ptm Dimethylated by PRMT1 at Arg-265. The methylation may favor cytoplasmic localization (By similarity)
Ptm Palmitoylated at Cys-452 by ZDHHC7 and ZDHHC21. This modification is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation, but not for signaling mediated by the nuclear hormone receptor (By similarity)
Ptm Phosphorylated by cyclin A/CDK2 and CK1. Phosphorylation probably enhances transcriptional activity. Dephosphorylation at Ser-123 by PPP5C inhibits its transactivation activity (By similarity)
Ptm Ubiquitinated. Deubiquitinated by OTUB1 (By similarity)
Similarity Belongs to the nuclear hormone receptor family. NR3 subfamily
Similarity Contains 1 nuclear receptor DNA-binding domain
Subcellular Location Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. Cytoplasm . Golgi apparatus {ECO:0000250}. Cell membrane . Note=Colocalizes with ZDHHC7 and ZDHHC21 in the Golgi apparatus where most probably palmitoylation occurs. Associated with the plasma membrane when palmitoylated
Subunit Interacts with BCAS3. Binds DNA as a homodimer (By similarity). Can form a heterodimer with ESR2 (By similarity). Interacts with coactivator NCOA5. Interacts with NCOA7; the interaction is ligand-inducible. Interacts with AKAP13, CUEDC2, HEXIM1, KDM5A, MAP1S, PELP1, SMARD1, and UBE1C. Interacts with MUC1; the interaction is stimulated by 7 beta-estradiol (E2) and enhances ERS1-mediated transcription. Interacts with DNTTIP2, and UIMC1. Interacts with KMT2D/MLL2. Interacts with ATAD2; the interaction is enhanced by estradiol. Interacts with KIF18A and LDB1. Interacts with RLIM (via its C-terminus). Interacts with MACROD1. Interacts with SH2D4A and PLCG. Interacts with SH2D4A; the interaction blocks binding to PLCG and inhibits estrogen- induced cell proliferation. Interacts with DYNLL1. Interacts with CCDC62; the interaction requires estradiol and appears to enhance the transcription of target genes. Interacts with NR2C1; the interaction prevents homodimerization of ESR1 and suppresses its transcriptional activity and cell growth. Interacts with DYX1C1. Interacts with PRMT2. Interacts with PI3KR1 or PIK3R2, SRC and PTK2/FAK1. Interacts with RBFOX2. Interacts with EP300; the interaction is estrogen-dependent and enhanced by CITED1. Interacts with CITED1; the interaction is estrogen-dependent (By similarity). Interacts with FAM120B, FOXL2, PHB2 and SLC30A9. Interacts with coactivators NCOA3 and NCOA6. Interacts with STK3/MST2 only in the presence of SAV1 and vice-versa. Binds to CSNK1D. Interacts with NCOA2; NCOA2 can interact with ESR1 AF-1 and AF-2 domains simultaneously and mediate their transcriptional synergy. Interacts with DDX5. Interacts with NCOA1; the interaction seems to require a self-association of N-terminal and C-terminal regions. Interacts with ZNF366, DDX17, NFKB1, RELA, SP1 and SP3. Interacts with NRIP1 (By similarity). Interacts with GPER1; the interaction occurs in an estrogen-dependent manner (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012446 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978815 RefSeq NP_036821 600 estrogen receptor

Identical Sequences to LMP012446 proteins

Reference Database Accession Length Protein Name
GI:6978815 EMBL CAA68287.1 600 unnamed protein product [Rattus norvegicus]
GI:6978815 SwissProt P06211.1 600 RecName: Full=Estrogen receptor; Short=ER; AltName: Full=ER-alpha; AltName: Full=Estradiol receptor; AltName: Full=Nuclear receptor subfamily 3 group A member 1 [Rattus norvegicus]

Related Sequences to LMP012446 proteins

Reference Database Accession Length Protein Name
GI:6978815 EMBL CAA68287.1 600 unnamed protein product [Rattus norvegicus]
GI:6978815 EMBL CAA43411.1 600 estrogen receeptor [Rattus norvegicus]
GI:6978815 SwissProt P06211.1 600 RecName: Full=Estrogen receptor; Short=ER; AltName: Full=ER-alpha; AltName: Full=Estradiol receptor; AltName: Full=Nuclear receptor subfamily 3 group A member 1 [Rattus norvegicus]