Gene/Proteome Database (LMPD)

LMPD ID
LMP012458
Gene ID
25035
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome b5 reductase 3
Gene Symbol
Cyb5r3
Synonyms
Dia1; Nadhcb5; RNNADHCB5;
Alternate Names
NADH-cytochrome b5 reductase 3; B5R; diaphorase 1; diaphorase-1; Diaphorase (NADH) (cytochrome b-5 reductase);
Chromosome
7
Map Location
7q34
EC Number
1.6.2.2
Summary
catalyzes the conversion of NADH, H+, and 2 ferricytochrome b(5) to NAD+ and 2 ferrocytochrome b(5) [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cyb5r3

Proteins

NADH-cytochrome b5 reductase 3
Refseq ID NP_620232
Protein GI 20302049
UniProt ID P20070
mRNA ID NM_138877
Length 301
MGAQLSTLSRVVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF

Gene Information

Entrez Gene ID
25035
Gene Name
cytochrome b5 reductase 3
Gene Symbol
Cyb5r3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:HGNC C endoplasmic reticulum membrane
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005811 IEA:Ensembl C lipid particle
GO:0005743 IEA:Ensembl C mitochondrial inner membrane
GO:0005741 IEA:UniProtKB-KW C mitochondrial outer membrane
GO:0043531 IDA:RGD F ADP binding
GO:0016208 IDA:RGD F AMP binding
GO:0071949 IEA:Ensembl F FAD binding
GO:0051287 IDA:RGD F NAD binding
GO:0004128 TAS:RGD F cytochrome-b5 reductase activity, acting on NAD(P)H
GO:0050660 IDA:RGD F flavin adenine dinucleotide binding
GO:0006695 IEA:UniProtKB-KW P cholesterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00520 Amino sugar and nucleotide sugar metabolism
rno00520 Amino sugar and nucleotide sugar metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953298 Defective AMN causes hereditary megaloblastic anemia 1
5953308 Defective BTD causes biotidinase deficiency
5953307 Defective CD320 causes methylmalonic aciduria
5953299 Defective CUBN causes hereditary megaloblastic anemia 1
5953296 Defective GIF causes intrinsic factor deficiency
5953310 Defective HLCS causes multiple carboxylase deficiency
5953297 Defective LMBRD1 causes methylmalonic aciduria and homocystinuria type cblF
5953305 Defective MMAA causes methylmalonic aciduria type cblA
5953302 Defective MMAB causes methylmalonic aciduria type cblB
5953304 Defective MMACHC causes methylmalonic aciduria and homocystinuria type cblC
5953303 Defective MMADHC causes methylmalonic aciduria and homocystinuria type cblD
5953301 Defective MTR causes methylmalonic aciduria and homocystinuria type cblG
5953300 Defective MTRR causes methylmalonic aciduria and homocystinuria type cblE
5953306 Defective MUT causes methylmalonic aciduria mut type
5953293 Defective TCN2 causes hereditary megaloblastic anemia
5953309 Defects in biotin (Btn) metabolism
5953294 Defects in cobalamin (B12) metabolism
5953295 Defects in vitamin and cofactor metabolism
5953253 Disease
5953250 Metabolism
5953292 Metabolism of vitamins and cofactors
5953291 Metabolism of water-soluble vitamins and cofactors
5954009 Vitamin C (ascorbate) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR017927 Ferredoxin reductase-type FAD-binding domain
IPR001709 Flavoprotein pyridine nucleotide cytochrome reductase
IPR001834 NADH:cytochrome b5 reductase (CBR)
IPR001433 Oxidoreductase FAD/NAD(P)-binding
IPR008333 Oxidoreductase, FAD-binding domain
IPR017938 Riboflavin synthase-like beta-barrel

UniProt Annotations

Entry Information

Gene Name
cytochrome b5 reductase 3
Protein Entry
NB5R3_RAT
UniProt ID
P20070
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative promoter usage, Alternative initiation; Named isoforms=3; Name=1; Synonyms=L-form reticulocyte reductase; IsoId=P20070-1; Sequence=Displayed; Note=Produced by alternative promoter usage.; Name=2; Synonyms=R-form reticulocyte reductase; IsoId=P20070-2; Sequence=VSP_009661; Note=Produced by alternative promoter usage.; Name=3; Synonyms=Soluble form; IsoId=P20070-3; Sequence=VSP_009660; Note=Produced by alternative initiation.;
Catalytic Activity NADH + 2 ferricytochrome b5 = NAD(+) + H(+) + 2 ferrocytochrome b5.
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence= ;
Function Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
Ptm Only the isoform 1 is myristoyled.
Similarity Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family
Similarity Contains 1 FAD-binding FR-type domain
Subcellular Location Isoform 1: Endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side. Mitochondrion outer membrane; Lipid-anchor; Cytoplasmic side.
Subcellular Location Isoform 3: Cytoplasm. Note=Produces the soluble form found in erythrocytes.
Subunit Component of a complex composed of cytochrome b5, NADH- cytochrome b5 reductase (CYB5R3) and MOSC2
Tissue Specificity Isoform 1 and isoform 3 are ubiquitously expressed. Isoform 2 is expressed only in erythroid tissues, reticulocytes and liver

Identical and Related Proteins

Unique RefSeq proteins for LMP012458 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20302049 RefSeq NP_620232 301 NADH-cytochrome b5 reductase 3

Identical Sequences to LMP012458 proteins

Reference Database Accession Length Protein Name
GI:20302049 EMBL CBX85095.1 301 unnamed protein product [Rattus norvegicus]
GI:20302049 EMBL CBX85184.1 301 unnamed protein product [Rattus norvegicus]
GI:20302049 GenBank AAH62066.1 301 Cytochrome b5 reductase 3 [Rattus norvegicus]
GI:20302049 GenBank EDM15637.1 301 cytochrome b5 reductase 3 [Rattus norvegicus]

Related Sequences to LMP012458 proteins

Reference Database Accession Length Protein Name
GI:20302049 EMBL CBX85095.1 301 unnamed protein product [Rattus norvegicus]
GI:20302049 EMBL CBX85184.1 301 unnamed protein product [Rattus norvegicus]
GI:20302049 SwissProt P20070.2 301 RecName: Full=NADH-cytochrome b5 reductase 3; Short=B5R; Short=Cytochrome b5 reductase; AltName: Full=Diaphorase-1; Contains: RecName: Full=NADH-cytochrome b5 reductase 3 membrane-bound form; Contains: RecName: Full=NADH-cytochrome b5 reductase 3 soluble form [Rattus norvegicus]