Gene/Proteome Database (LMPD)

LMPD ID
LMP012459
Gene ID
25045
Species
Rattus norvegicus (Rat)
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
Dbi
Synonyms
Ep; Odn; Ttn; Acbp; Acoabp3; RNACOABP3;
Alternate Names
acyl-CoA-binding protein; LRRGT00046; endozepine; octadecaneuropeptide; GABA receptor modulator; diazepam-binding inhibitor; triakontatetraneuropeptide; Diazepam binding inhibitor (GABA receptor modulator acyl-Coenxyme A binding protein); Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein);
Chromosome
13
Map Location
13q13
Summary
plays a role in the regulation of mitochondrial steroidogenesis and acyl-CoA metabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Dbi

Proteins

acyl-CoA-binding protein
Refseq ID NP_114054
Protein GI 13937379
UniProt ID P11030
mRNA ID NM_031853
Length 87
MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI

Gene Information

Entrez Gene ID
25045
Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Gene Symbol
Dbi
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043292 IDA:RGD C contractile fiber
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0005615 IDA:MGI C extracellular space
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005634 IDA:RGD C nucleus
GO:0005886 IDA:RGD C plasma membrane
GO:0008021 IDA:MGI C synaptic vesicle
GO:0030156 IDA:RGD F benzodiazepine receptor binding
GO:0000062 IPI:RGD F fatty-acyl-CoA binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006637 TAS:RGD P acyl-CoA metabolic process
GO:0007420 IEP:RGD P brain development
GO:0031670 IEP:RGD P cellular response to nutrient
GO:0014009 IDA:RGD P glial cell proliferation
GO:0031999 IDA:RGD P negative regulation of fatty acid beta-oxidation
GO:0030157 IEP:RGD P pancreatic juice secretion
GO:0046889 IDA:RGD P positive regulation of lipid biosynthetic process
GO:0051281 IMP:RGD P positive regulation of release of sequestered calcium ion into cytosol
GO:0032228 IDA:MGI P regulation of synaptic transmission, GABAergic
GO:0006694 TAS:RGD P steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
Protein Entry
ACBP_RAT
UniProt ID
P11030
Species
Rat

Comments

Comment Type Description
Function Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Similarity Belongs to the ACBP family
Similarity Contains 1 ACB (acyl-CoA-binding) domain
Subcellular Location Endoplasmic reticulum . Golgi apparatus . Note=Golgi localization is dependent on ligand binding
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP012459 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13937379 RefSeq NP_114054 87 acyl-CoA-binding protein

Identical Sequences to LMP012459 proteins

Reference Database Accession Length Protein Name
GI:13937379 EMBL CAA65396.1 87 multifunctional acyl-CoA-binding protein [Rattus norvegicus]
GI:13937379 GenBank AAA12824.1 87 acyl-CoA-binding protein [Rattus norvegicus]
GI:13937379 GenBank AAH84717.1 87 Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) [Rattus norvegicus]
GI:13937379 GenBank EDL87933.1 87 rCG37628 [Rattus norvegicus]

Related Sequences to LMP012459 proteins

Reference Database Accession Length Protein Name
GI:13937379 GenBank AAH84717.1 87 Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) [Rattus norvegicus]
GI:13937379 GenBank EDL87933.1 87 rCG37628 [Rattus norvegicus]
GI:13937379 SwissProt P11030.3 87 RecName: Full=Acyl-CoA-binding protein; Short=ACBP; AltName: Full=Diazepam-binding inhibitor; Short=DBI; AltName: Full=Endozepine; Short=EP; Contains: RecName: Full=Triakontatetraneuropeptide; Short=TTN; Contains: RecName: Full=Octadecaneuropeptide; Short=ODN [Rattus norvegicus]