Gene/Proteome Database (LMPD)

LMPD ID
LMP012461
Gene ID
25047
Species
Rattus norvegicus (Rat)
Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Gene Symbol
Fcer1a
Synonyms
Iger01; RATIGER01;
Alternate Names
high affinity immunoglobulin epsilon receptor subunit alpha; fcERI; alpha polypeptide; fc-epsilon RI-alpha; igE Fc receptor subunit alpha; Fc receptor, IgE, high affinity I, alpha polypeptide;
Chromosome
13
Map Location
13q24
Summary
alpha subunit of the high affinity IgE receptor, which binds IgE and mediates allergic response [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fcer1a

Proteins

high affinity immunoglobulin epsilon receptor subunit alpha precursor
Refseq ID NP_036856
Protein GI 6978833
UniProt ID P12371
mRNA ID NM_012724
Length 245
MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG
sig_peptide: 1..23 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P12371.1) calculated_mol_wt: 2335 peptide sequence: MDTGGSARLCLALVLISLGVMLT mat_peptide: 24..245 product: High affinity immunoglobulin epsilon receptor subunit alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P12371.1) calculated_mol_wt: 25476 peptide sequence: ATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIHNDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDIRCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAVVKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG

Gene Information

Entrez Gene ID
25047
Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Gene Symbol
Fcer1a
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0019863 TAS:RGD F IgE binding
GO:0019768 TAS:RGD F high-affinity IgE receptor activity
GO:0038095 TAS:GOC P Fc-epsilon receptor signaling pathway
GO:0006955 TAS:RGD P immune response

KEGG Pathway Links

KEGG Pathway ID Description
ko05310 Asthma
rno05310 Asthma
ko04664 Fc epsilon RI signaling pathway
rno04664 Fc epsilon RI signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR003599 Immunoglobulin subtype
IPR007110 Immunoglobulin-like domain
IPR013783 Immunoglobulin-like fold

UniProt Annotations

Entry Information

Gene Name
Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
Protein Entry
FCERA_RAT
UniProt ID
P12371
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P12371-1; Sequence=Displayed; Name=2; IsoId=P12371-2; Sequence=VSP_012760, VSP_012761;
Function Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Induction Exhibits night/day variations with a 15-fold increased expression at night in the pineal gland. Up-regulation is due to a large degree to the release of norepinephrine from nerve terminals in the pineal gland and cAMP signaling pathway (at protein level)
Similarity Contains 2 Ig-like (immunoglobulin-like) domains
Subcellular Location Isoform 1: Cell membrane; Single-pass type I membrane protein.
Subcellular Location Isoform 2: Secreted.
Subunit Tetramer of an alpha chain, a beta chain, and two disulfide linked gamma chains.
Tissue Specificity Expressed in leukocytes and pinealocytes at night (at protein level). {ECO:0000269|PubMed:17728245, ECO:0000269|PubMed:19103603}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012461 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978833 RefSeq NP_036856 245 high affinity immunoglobulin epsilon receptor subunit alpha precursor

Identical Sequences to LMP012461 proteins

Reference Database Accession Length Protein Name
GI:6978833 GenBank AAA41582.1 245 mast cell IgE receptor alpha-chain [Rattus norvegicus]
GI:6978833 GenBank AAA42045.1 245 immunoglobulin E receptor alpha subunit precursor [Rattus norvegicus]
GI:6978833 SwissProt P12371.1 245 RecName: Full=High affinity immunoglobulin epsilon receptor subunit alpha; AltName: Full=Fc-epsilon RI-alpha; Short=FcERI; AltName: Full=IgE Fc receptor subunit alpha; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012461 proteins

Reference Database Accession Length Protein Name
GI:6978833 GenBank AAA41582.1 245 mast cell IgE receptor alpha-chain [Rattus norvegicus]
GI:6978833 GenBank AAA42045.1 245 immunoglobulin E receptor alpha subunit precursor [Rattus norvegicus]
GI:6978833 SwissProt P12371.1 245 RecName: Full=High affinity immunoglobulin epsilon receptor subunit alpha; AltName: Full=Fc-epsilon RI-alpha; Short=FcERI; AltName: Full=IgE Fc receptor subunit alpha; Flags: Precursor [Rattus norvegicus]