Gene/Proteome Database (LMPD)
LMPD ID
LMP012464
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cellular retinoic acid binding protein 1
Gene Symbol
Alternate Names
cellular retinoic acid-binding protein 1; CRABP-I; cellular retinoic acid binding protein I; cellular retinoic acid-binding protein I;
Chromosome
8
Map Location
8q24
Summary
cytosolic protein that binds all-trans retinoic acid and may play a role in neurogenesis [RGD, Feb 2006]
Orthologs
Proteins
| cellular retinoic acid-binding protein 1 | |
|---|---|
| Refseq ID | NP_001099186 |
| Protein GI | 157787087 |
| UniProt ID | P62966 |
| mRNA ID | NM_001105716 |
| Length | 137 |
| MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE | |
Gene Information
Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:RGD | C | cytosol |
| GO:0016918 | IEA:UniProtKB-KW | F | retinal binding |
| GO:0001972 | IDA:RGD | F | retinoic acid binding |
| GO:0019841 | IEA:UniProtKB-KW | F | retinol binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953288 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5953467 | Import of palmitoyl-CoA into the mitochondrial matrix |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953268 | Pyruvate metabolism |
| 5953269 | Pyruvate metabolism and Citric Acid (TCA) cycle |
| 5954047 | Regulation of pyruvate dehydrogenase (PDH) complex |
| 5953270 | The citric acid (TCA) cycle and respiratory electron transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cellular retinoic acid binding protein 1
Protein Entry
RABP1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Domain | Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior |
| Function | Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors. |
| Similarity | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family |
| Subcellular Location | Cytoplasm. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012464 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157787087 | RefSeq | NP_001099186 | 137 | cellular retinoic acid-binding protein 1 |
Identical Sequences to LMP012464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157787087 | RefSeq | XP_005906662.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 isoform X2 [Bos mutus] |
| GI:157787087 | RefSeq | XP_005985062.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Pantholops hodgsonii] |
| GI:157787087 | RefSeq | XP_006971637.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 isoform X1 [Peromyscus maniculatus bairdii] |
| GI:157787087 | RefSeq | XP_006044444.1 | 137 | PREDICTED: cellular retinoic acid-binding protein 1 [Bubalus bubalis] |
Related Sequences to LMP012464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157787087 | EMBL | CAA33790.1 | 137 | cellular reinoid acid binding protein [Mus musculus] |
| GI:157787087 | EMBL | CAA33509.1 | 137 | unnamed protein product [Mus sp.] |
| GI:157787087 | GenBank | AAA30470.1 | 137 | retinoic acid-binding protein [Bos taurus] |