Gene/Proteome Database (LMPD)

LMPD ID
LMP012473
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Alternate Names
corticosteroid 11-beta-dehydrogenase isozyme 2; 11-DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; Hydroxysteroid dehydrogenase, 11 beta type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase;
Chromosome
19
Map Location
19q11-q12
EC Number
1.1.1.-
Summary
catalyzes the conversion of corticosterone to 11-dehydrocorticosterone [RGD, Feb 2006]
Orthologs

Proteins

corticosteroid 11-beta-dehydrogenase isozyme 2
Refseq ID NP_058777
Protein GI 8393573
UniProt ID P50233
mRNA ID NM_017081
Length 400
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGPGALELRARCSPRLKLLQMDLTKPEDISRVLEITKAHTASTGLWGLVNNAGLNMVVADVELSPVVTFRECMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYIEHLHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRRRFLQNFFISHLLPRALRPGQPGPVHDTTQDPNPSPTVSAL

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0003845 IDA:RGD F 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity
GO:0051287 IDA:RGD F NAD binding
GO:0016491 IDA:RGD F oxidoreductase activity
GO:0005496 IPI:RGD F steroid binding
GO:0007565 IEP:RGD P female pregnancy
GO:0008211 IDA:RGD P glucocorticoid metabolic process
GO:0008152 IDA:RGD P metabolic process
GO:0002017 IMP:RGD P regulation of blood volume by renal aldosterone
GO:0042493 IEP:RGD P response to drug
GO:0032094 IEP:RGD P response to food
GO:0051384 IEP:RGD P response to glucocorticoid
GO:0001666 IEP:RGD P response to hypoxia
GO:0032868 IEP:RGD P response to insulin
GO:0048545 IEP:RGD P response to steroid hormone

KEGG Pathway Links

KEGG Pathway ID Description
ko04960 Aldosterone-regulated sodium reabsorption
rno04960 Aldosterone-regulated sodium reabsorption
M00109 C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Protein Entry
DHI2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity An 11-beta-hydroxysteroid + NAD(+) = an 11- oxosteroid + NADH.
Function Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Microsome. Endoplasmic reticulum .
Subunit Interacts with ligand-free cytoplasmic NR3C2
Tissue Specificity Highly expressed in kidney, adrenal gland and distal colon. Detected at much lower levels in lung.

Identical and Related Proteins

Unique RefSeq proteins for LMP012473 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393573 RefSeq NP_058777 400 corticosteroid 11-beta-dehydrogenase isozyme 2

Identical Sequences to LMP012473 proteins

Reference Database Accession Length Protein Name
GI:8393573 GenBank AAA87007.1 400 11-beta-hydroxylsteroid dehydrogenase type 2 [Rattus norvegicus]
GI:8393573 GenBank AAH87023.1 400 Hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus]
GI:8393573 GenBank EDL92380.1 400 hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus]
GI:8393573 SwissProt P50233.1 400 RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type 2; Short=11-DH2; Short=11-beta-HSD2; AltName: Full=NAD-dependent 11-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]

Related Sequences to LMP012473 proteins

Reference Database Accession Length Protein Name
GI:8393573 GenBank AAA87007.1 400 11-beta-hydroxylsteroid dehydrogenase type 2 [Rattus norvegicus]
GI:8393573 GenBank AAH87023.1 400 Hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus]
GI:8393573 GenBank EDL92380.1 400 hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus]