Gene/Proteome Database (LMPD)
LMPD ID
LMP012473
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Alternate Names
corticosteroid 11-beta-dehydrogenase isozyme 2; 11-DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; Hydroxysteroid dehydrogenase, 11 beta type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase;
Chromosome
19
Map Location
19q11-q12
EC Number
1.1.1.-
Summary
catalyzes the conversion of corticosterone to 11-dehydrocorticosterone [RGD, Feb 2006]
Orthologs
Proteins
| corticosteroid 11-beta-dehydrogenase isozyme 2 | |
|---|---|
| Refseq ID | NP_058777 |
| Protein GI | 8393573 |
| UniProt ID | P50233 |
| mRNA ID | NM_017081 |
| Length | 400 |
| MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVVLAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNGPGALELRARCSPRLKLLQMDLTKPEDISRVLEITKAHTASTGLWGLVNNAGLNMVVADVELSPVVTFRECMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVNLWEKRKQLLLANLPRELLQAYGEDYIEHLHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYTGRGLGLMYFIHHYLPGGLRRRFLQNFFISHLLPRALRPGQPGPVHDTTQDPNPSPTVSAL | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:RGD | C | cytoplasm |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0003845 | IDA:RGD | F | 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity |
| GO:0051287 | IDA:RGD | F | NAD binding |
| GO:0016491 | IDA:RGD | F | oxidoreductase activity |
| GO:0005496 | IPI:RGD | F | steroid binding |
| GO:0007565 | IEP:RGD | P | female pregnancy |
| GO:0008211 | IDA:RGD | P | glucocorticoid metabolic process |
| GO:0008152 | IDA:RGD | P | metabolic process |
| GO:0002017 | IMP:RGD | P | regulation of blood volume by renal aldosterone |
| GO:0042493 | IEP:RGD | P | response to drug |
| GO:0032094 | IEP:RGD | P | response to food |
| GO:0051384 | IEP:RGD | P | response to glucocorticoid |
| GO:0001666 | IEP:RGD | P | response to hypoxia |
| GO:0032868 | IEP:RGD | P | response to insulin |
| GO:0048545 | IEP:RGD | P | response to steroid hormone |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid 11-beta dehydrogenase 2
Protein Entry
DHI2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | An 11-beta-hydroxysteroid + NAD(+) = an 11- oxosteroid + NADH. |
| Function | Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
| Subcellular Location | Microsome. Endoplasmic reticulum . |
| Subunit | Interacts with ligand-free cytoplasmic NR3C2 |
| Tissue Specificity | Highly expressed in kidney, adrenal gland and distal colon. Detected at much lower levels in lung. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012473 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 8393573 | RefSeq | NP_058777 | 400 | corticosteroid 11-beta-dehydrogenase isozyme 2 |
Identical Sequences to LMP012473 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8393573 | GenBank | AAA87007.1 | 400 | 11-beta-hydroxylsteroid dehydrogenase type 2 [Rattus norvegicus] |
| GI:8393573 | GenBank | AAH87023.1 | 400 | Hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus] |
| GI:8393573 | GenBank | EDL92380.1 | 400 | hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus] |
| GI:8393573 | SwissProt | P50233.1 | 400 | RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type 2; Short=11-DH2; Short=11-beta-HSD2; AltName: Full=NAD-dependent 11-beta-hydroxysteroid dehydrogenase [Rattus norvegicus] |
Related Sequences to LMP012473 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8393573 | GenBank | AAA87007.1 | 400 | 11-beta-hydroxylsteroid dehydrogenase type 2 [Rattus norvegicus] |
| GI:8393573 | GenBank | AAH87023.1 | 400 | Hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus] |
| GI:8393573 | GenBank | EDL92380.1 | 400 | hydroxysteroid 11-beta dehydrogenase 2 [Rattus norvegicus] |