Gene/Proteome Database (LMPD)
LMPD ID
LMP012502
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prohibitin
Gene Symbol
Alternate Names
prohibitin;
Chromosome
10
Map Location
chromosome:10
Summary
inhibits entry into S phase of the mitotic cell cycle; involved in negative regulation of cell proliferation [RGD, Feb 2006]
Orthologs
Proteins
| prohibitin | |
|---|---|
| Refseq ID | NP_114039 |
| Protein GI | 13937353 |
| UniProt ID | P67779 |
| mRNA ID | NM_031851 |
| Length | 272 |
| MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:RGD | C | cytoplasm |
| GO:0031315 | IDA:RGD | C | extrinsic component of mitochondrial outer membrane |
| GO:0030061 | IDA:RGD | C | mitochondrial crista |
| GO:0005739 | IDA:RGD | C | mitochondrion |
| GO:0005634 | IDA:RGD | C | nucleus |
| GO:0006260 | IEA:UniProtKB-KW | P | DNA replication |
| GO:0043066 | IMP:RGD | P | negative regulation of apoptotic process |
| GO:0008285 | IMP:RGD | P | negative regulation of cell proliferation |
| GO:0031100 | IEP:RGD | P | organ regeneration |
| GO:0001552 | IEP:RGD | P | ovarian follicle atresia |
| GO:0001541 | IEP:RGD | P | ovarian follicle development |
| GO:0034097 | IEP:RGD | P | response to cytokine |
| GO:0042493 | IEP:RGD | P | response to drug |
| GO:0045471 | IEP:RGD | P | response to ethanol |
| GO:0035902 | IEP:RGD | P | response to immobilization stress |
| GO:0043434 | IEP:RGD | P | response to peptide hormone |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas |
| Function | Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging. |
| Similarity | Belongs to the prohibitin family |
| Subcellular Location | Mitochondrion inner membrane . |
| Subunit | Interacts with PHB2. Interacts with STOML2 (By similarity) |
| Tissue Specificity | Expressed in brain, heart, intestine, kidney, liver, skeletal muscle. Highest levels in heart, liver, kidney and intestine. Also expressed in flagella of epididymal sperm |
Identical and Related Proteins
Unique RefSeq proteins for LMP012502 (as displayed in Record Overview)
Identical Sequences to LMP012502 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13937353 | RefSeq | XP_005075923.1 | 272 | PREDICTED: prohibitin [Mesocricetus auratus] |
| GI:13937353 | RefSeq | XP_006924839.1 | 272 | PREDICTED: prohibitin [Pteropus alecto] |
| GI:13937353 | RefSeq | XP_007642664.1 | 272 | PREDICTED: prohibitin [Cricetulus griseus] |
| GI:13937353 | RefSeq | XP_007642665.1 | 272 | PREDICTED: prohibitin [Cricetulus griseus] |
Related Sequences to LMP012502 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13937353 | DBBJ | BAB27067.1 | 272 | unnamed protein product [Mus musculus] |
| GI:13937353 | GenBank | AAH97304.1 | 272 | Prohibitin [Rattus norvegicus] |
| GI:13937353 | RefSeq | XP_006924839.1 | 272 | PREDICTED: prohibitin [Pteropus alecto] |