Gene/Proteome Database (LMPD)
LMPD ID
LMP012502
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prohibitin
Gene Symbol
Alternate Names
prohibitin;
Chromosome
10
Map Location
chromosome:10
Summary
inhibits entry into S phase of the mitotic cell cycle; involved in negative regulation of cell proliferation [RGD, Feb 2006]
Orthologs
Proteins
prohibitin | |
---|---|
Refseq ID | NP_114039 |
Protein GI | 13937353 |
UniProt ID | P67779 |
mRNA ID | NM_031851 |
Length | 272 |
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:RGD | C | cytoplasm |
GO:0031315 | IDA:RGD | C | extrinsic component of mitochondrial outer membrane |
GO:0030061 | IDA:RGD | C | mitochondrial crista |
GO:0005739 | IDA:RGD | C | mitochondrion |
GO:0005634 | IDA:RGD | C | nucleus |
GO:0006260 | IEA:UniProtKB-KW | P | DNA replication |
GO:0043066 | IMP:RGD | P | negative regulation of apoptotic process |
GO:0008285 | IMP:RGD | P | negative regulation of cell proliferation |
GO:0031100 | IEP:RGD | P | organ regeneration |
GO:0001552 | IEP:RGD | P | ovarian follicle atresia |
GO:0001541 | IEP:RGD | P | ovarian follicle development |
GO:0034097 | IEP:RGD | P | response to cytokine |
GO:0042493 | IEP:RGD | P | response to drug |
GO:0045471 | IEP:RGD | P | response to ethanol |
GO:0035902 | IEP:RGD | P | response to immobilization stress |
GO:0043434 | IEP:RGD | P | response to peptide hormone |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Developmental Stage | Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas |
Function | Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging. |
Similarity | Belongs to the prohibitin family |
Subcellular Location | Mitochondrion inner membrane . |
Subunit | Interacts with PHB2. Interacts with STOML2 (By similarity) |
Tissue Specificity | Expressed in brain, heart, intestine, kidney, liver, skeletal muscle. Highest levels in heart, liver, kidney and intestine. Also expressed in flagella of epididymal sperm |
Identical and Related Proteins
Unique RefSeq proteins for LMP012502 (as displayed in Record Overview)
Identical Sequences to LMP012502 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13937353 | RefSeq | XP_005075923.1 | 272 | PREDICTED: prohibitin [Mesocricetus auratus] |
GI:13937353 | RefSeq | XP_006924839.1 | 272 | PREDICTED: prohibitin [Pteropus alecto] |
GI:13937353 | RefSeq | XP_007642664.1 | 272 | PREDICTED: prohibitin [Cricetulus griseus] |
GI:13937353 | RefSeq | XP_007642665.1 | 272 | PREDICTED: prohibitin [Cricetulus griseus] |
Related Sequences to LMP012502 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13937353 | DBBJ | BAB27067.1 | 272 | unnamed protein product [Mus musculus] |
GI:13937353 | GenBank | AAH97304.1 | 272 | Prohibitin [Rattus norvegicus] |
GI:13937353 | RefSeq | XP_006924839.1 | 272 | PREDICTED: prohibitin [Pteropus alecto] |