Gene/Proteome Database (LMPD)

LMPD ID
LMP012526
Gene ID
25557
Species
Rattus norvegicus (Rat)
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Star
Alternate Names
steroidogenic acute regulatory protein, mitochondrial; stARD1; START domain-containing protein 1;
Chromosome
16
Map Location
16q12.4
Summary
transports cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane; plays a role in steroidogenesis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Star

Proteins

steroidogenic acute regulatory protein, mitochondrial precursor
Refseq ID NP_113746
Protein GI 13928754
UniProt ID P97826
mRNA ID NM_031558
Length 284
MLLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNRRALGDPSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEEAMQKALGILNNQEGWKKESQQENGDEVLSKVVPGVGKVFRLEVLLDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLKKIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFASHLRKRLESSPASEAQC
transit_peptide: 1..62 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (P97826.1) calculated_mol_wt: 6923 peptide sequence: MLLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNRRALGDPSPGWMGQVRRRSSLLGSQL mat_peptide: 63..284 product: Steroidogenic acute regulatory protein, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P97826.1) calculated_mol_wt: 24596 peptide sequence: EATLYSDQELSYIQQGEEAMQKALGILNNQEGWKKESQQENGDEVLSKVVPGVGKVFRLEVLLDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLKKIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFASHLRKRLESSPASEAQC

Gene Information

Entrez Gene ID
25557
Gene Name
steroidogenic acute regulatory protein
Gene Symbol
Star
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:RGD C cytosol
GO:0030061 IDA:RGD C mitochondrial crista
GO:0005758 IDA:RGD C mitochondrial intermembrane space
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0017127 TAS:RGD F cholesterol transporter activity
GO:0006699 IDA:RGD P bile acid biosynthetic process
GO:0018879 IEP:RGD P biphenyl metabolic process
GO:0007420 IEP:RGD P brain development
GO:0071312 IEP:RGD P cellular response to alkaloid
GO:0071236 IEP:RGD P cellular response to antibiotic
GO:0071320 IEP:RGD P cellular response to cAMP
GO:0071276 IEP:RGD P cellular response to cadmium ion
GO:0071549 IEP:RGD P cellular response to dexamethasone stimulus
GO:0071872 IEP:RGD P cellular response to epinephrine stimulus
GO:0044344 IEP:RGD P cellular response to fibroblast growth factor stimulus
GO:0071372 IEP:RGD P cellular response to follicle-stimulating hormone stimulus
GO:0071333 IEP:RGD P cellular response to glucose stimulus
GO:0071371 IEP:RGD P cellular response to gonadotropin stimulus
GO:0071378 IEP:RGD P cellular response to growth hormone stimulus
GO:0032869 IEP:RGD P cellular response to insulin stimulus
GO:0035457 IMP:RGD P cellular response to interferon-alpha
GO:0071346 IEP:RGD P cellular response to interferon-gamma
GO:0071222 IEP:RGD P cellular response to lipopolysaccharide
GO:0071373 IEP:RGD P cellular response to luteinizing hormone stimulus
GO:0071248 IEP:RGD P cellular response to metal ion
GO:0071407 IEP:RGD P cellular response to organic cyclic compound
GO:0071560 IEP:RGD P cellular response to transforming growth factor beta stimulus
GO:0008203 IEA:UniProtKB-UniPathway P cholesterol metabolic process
GO:0007623 IEP:RGD P circadian rhythm
GO:0042747 IEP:RGD P circadian sleep/wake cycle, REM sleep
GO:0018894 IEP:RGD P dibenzo-p-dioxin metabolic process
GO:0016101 IEP:RGD P diterpenoid metabolic process
GO:0006703 IMP:RGD P estrogen biosynthetic process
GO:0050756 IEP:RGD P fractalkine metabolic process
GO:0008211 IEA:Ensembl P glucocorticoid metabolic process
GO:0017143 IEP:RGD P insecticide metabolic process
GO:0032367 IEP:RGD P intracellular cholesterol transport
GO:0008584 IEP:RGD P male gonad development
GO:0043524 IMP:RGD P negative regulation of neuron apoptotic process
GO:0006082 IEP:RGD P organic acid metabolic process
GO:0018958 IEP:RGD P phenol-containing compound metabolic process
GO:0018963 IEP:RGD P phthalate metabolic process
GO:0010628 IMP:RGD P positive regulation of gene expression
GO:0050769 IMP:RGD P positive regulation of neurogenesis
GO:0006701 IEP:RGD P progesterone biosynthetic process
GO:0048168 IMP:RGD P regulation of neuronal synaptic plasticity
GO:0050810 IEA:Ensembl P regulation of steroid biosynthetic process
GO:0014823 IEP:RGD P response to activity
GO:0046677 IEP:RGD P response to antibiotic
GO:0051412 IEP:RGD P response to corticosterone
GO:0042493 IEP:RGD P response to drug
GO:0043627 IEP:RGD P response to estrogen
GO:0045471 IEP:RGD P response to ethanol
GO:0060992 IEP:RGD P response to fungicide
GO:0034698 IEP:RGD P response to gonadotropin
GO:0009635 IEP:RGD P response to herbicide
GO:0042542 IEP:RGD P response to hydrogen peroxide
GO:0017085 IEP:RGD P response to insecticide
GO:0010212 IEP:RGD P response to ionizing radiation
GO:0010288 IEP:RGD P response to lead ion
GO:0044321 IEP:RGD P response to leptin
GO:0035094 IEP:RGD P response to nicotine
GO:0007584 IEP:RGD P response to nutrient
GO:0031667 IEP:RGD P response to nutrient levels
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0010033 IEP:RGD P response to organic substance
GO:0043434 IEP:RGD P response to peptide hormone
GO:0048545 IEP:RGD P response to steroid hormone
GO:0009636 IEP:RGD P response to toxic substance
GO:0006694 TAS:RGD P steroid biosynthetic process
GO:0061370 IEP:RGD P testosterone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04913 Ovarian steroidogenesis
rno04913 Ovarian steroidogenesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953937 Metabolism of steroid hormones and vitamin D
5953939 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom
IPR000799 Steroidogenic acute regulatory protein-like

UniProt Annotations

Entry Information

Gene Name
steroidogenic acute regulatory protein
Protein Entry
STAR_RAT
UniProt ID
P97826
Species
Rat

Comments

Comment Type Description
Function Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone (By similarity)
Pathway Steroid metabolism; cholesterol metabolism.
Similarity Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}.
Subcellular Location Mitochondrion.
Subunit May interact with TSPO

Identical and Related Proteins

Unique RefSeq proteins for LMP012526 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13928754 RefSeq NP_113746 284 steroidogenic acute regulatory protein, mitochondrial precursor

Identical Sequences to LMP012526 proteins

Reference Database Accession Length Protein Name
GI:13928754 DBBJ BAA34737.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:13928754 GenBank AAC02528.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:13928754 GenBank AAH88859.1 284 Steroidogenic acute regulatory protein [Rattus norvegicus]
GI:13928754 GenBank EDM09070.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]

Related Sequences to LMP012526 proteins

Reference Database Accession Length Protein Name
GI:13928754 DBBJ BAA19245.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:13928754 GenBank EDM09070.1 284 steroidogenic acute regulatory protein [Rattus norvegicus]
GI:13928754 SwissProt P97826.1 284 RecName: Full=Steroidogenic acute regulatory protein, mitochondrial; Short=StAR; AltName: Full=START domain-containing protein 1; Short=StARD1; Flags: Precursor [Rattus norvegicus]