Gene/Proteome Database (LMPD)

LMPD ID
LMP012533
Gene ID
25598
Species
Rattus norvegicus (Rat)
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Fabp2
Synonyms
FABP;
Alternate Names
fatty acid-binding protein, intestinal; FABPI; I-FABP; fatty acid binding protein 1; fatty acid-binding protein 2; intestinal fatty acid binding protein; intestinal-type fatty acid-binding protein;
Chromosome
2
Map Location
2q42
Summary
may play roles in fatty acid transport and compartmentalization [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fabp2

Proteins

fatty acid-binding protein, intestinal
Refseq ID NP_037200
Protein GI 6978827
UniProt ID P02693
mRNA ID NM_013068
Length 132
MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Gene Information

Entrez Gene ID
25598
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Fabp2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045179 IDA:RGD C apical cortex
GO:0005737 IDA:RGD C cytoplasm
GO:0005902 IDA:RGD C microvillus
GO:0005886 IDA:RGD C plasma membrane
GO:0005504 IDA:RGD F fatty acid binding
GO:0005324 IDA:RGD F long-chain fatty acid transporter activity
GO:0006631 IDA:RGD P fatty acid metabolic process
GO:0015908 IEP:RGD P fatty acid transport
GO:0050892 IDA:RGD P intestinal absorption
GO:0015909 IDA:RGD P long-chain fatty acid transport

KEGG Pathway Links

KEGG Pathway ID Description
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 2, intestinal
Protein Entry
FABPI_RAT
UniProt ID
P02693
Species
Rat

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor (By similarity)
Induction By peptide YY
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
Subcellular Location Cytoplasm.
Tissue Specificity Expressed in the small intestine. Expression in the mucosal cells of the ileum extends from the midvillar region to the villus tips

Identical and Related Proteins

Unique RefSeq proteins for LMP012533 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978827 RefSeq NP_037200 132 fatty acid-binding protein, intestinal

Identical Sequences to LMP012533 proteins

Reference Database Accession Length Protein Name
GI:6978827 GenBank EDL82110.1 132 fatty acid binding protein 2, intestinal [Rattus norvegicus]
GI:6978827 GenBank AGA40477.1 132 Sequence 21 from patent US 8321143
GI:6978827 GenBank AGA40484.1 132 Sequence 28 from patent US 8321143
GI:6978827 PDB 1IFC 132 Chain A, Refinement Of The Structure Of Recombinant Rat Intestinal Fatty Acid- Binding Apoprotein At 1.2 Angstroms Resolution

Related Sequences to LMP012533 proteins

Reference Database Accession Length Protein Name
GI:6978827 PRF - 132 protein,fatty acid binding [Rattus norvegicus]
GI:6978827 PRF - 132 protein,fatty acid binding [Rattus norvegicus]
GI:6978827 SwissProt P02693.4 132 RecName: Full=Fatty acid-binding protein, intestinal; AltName: Full=Fatty acid-binding protein 2; AltName: Full=Intestinal-type fatty acid-binding protein; Short=I-FABP [Rattus norvegicus]