Gene/Proteome Database (LMPD)

LMPD ID
LMP012572
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
squalene epoxidase
Gene Symbol
Alternate Names
squalene monooxygenase; SE;
Chromosome
7
Map Location
7q33
EC Number
1.14.13.132
Summary
enzyme that catalyzes sterol biosyntesis; may be the rare-limiting step in sterol biosynthesis pathway [RGD, Feb 2006]
Orthologs

Proteins

squalene monooxygenase
Refseq ID NP_058832
Protein GI 8394354
UniProt ID P52020
mRNA ID NM_017136
Length 573
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRNGGLLGRHQSGSQFAAFSDILSALPLIGFFWAKSPPESEKKEQLESKRRRKEVNLSETTLTGAATSVSTSSVTDPEVIIIGSGVLGSALATVLSRDGRTVTVIERDLKEPDRILGECLQPGGYRVLRELGLGDTVESLNAHHIHGYVIHDCESRSEVQIPYPVSENNQVQSGVAFHHGKFIMSLRKAAMAEPNVKFIEGVVLRLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKNLISNKVSVSSHFVGFIMKDAPQFKANFAELVLVDPSPVLIYQISPSETRVLVDIRGELPRNLREYMTEQIYPQIPDHLKESFLEACQNARLRTMPASFLPPSSVNKRGVLLLGDAYNLRHPLTGGGMTVALKDIKIWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRSHSFVVNVLAQALYELFSATDDSLRQLRKACFLYFKLGGECLTGPVGLLSILSPDPLLLIRHFFSVAVYATYFCFKSEPWATKPRALFSSGAILYKACSIIFPLIYSEMKYLVH

Gene Information

Entrez Gene ID
Gene Name
squalene epoxidase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0050660 IEA:InterPro F flavin adenine dinucleotide binding
GO:0004506 IDA:RGD F squalene monooxygenase activity
GO:0006725 IDA:RGD P cellular aromatic compound metabolic process
GO:0008203 IMP:RGD P cholesterol metabolic process
GO:0010033 IDA:RGD P response to organic substance

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00100 Steroid biosynthesis
rno00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5954496 Activation of gene expression by SREBF (SREBP)
5953924 Cholesterol biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954497 Regulation of cholesterol biosynthesis by SREBP (SREBF)

Domain Information

InterPro Annotations

Accession Description
IPR003042 Aromatic-ring hydroxylase-like
IPR013698 Squalene_epoxidase

UniProt Annotations

Entry Information

Gene Name
squalene epoxidase
Protein Entry
ERG1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Squalene + NADPH + O(2) = (3S)-2,3-epoxy-2,3- dihydrosqualene + NADP(+) + H(2)O.
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692;
Function Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.
Pathway Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3.
Similarity Belongs to the squalene monooxygenase family
Subcellular Location Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Subunit May form a complex with squalene synthase.

Identical and Related Proteins

Unique RefSeq proteins for LMP012572 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8394354 RefSeq NP_058832 573 squalene monooxygenase

Identical Sequences to LMP012572 proteins

Reference Database Accession Length Protein Name
GI:8394354 GenBank AAE03454.1 573 Sequence 4 from patent US 5861496
GI:8394354 GenBank AAE55206.1 573 Sequence 7 from patent US 6153815
GI:8394354 GenBank AAH97330.1 573 Sqle protein [Rattus norvegicus]
GI:8394354 GenBank EDM16202.1 573 squalene epoxidase [Rattus norvegicus]

Related Sequences to LMP012572 proteins

Reference Database Accession Length Protein Name
GI:8394354 DBBJ BAA07141.1 573 squalene epoxidase [Rattus norvegicus]
GI:8394354 GenBank AAE55206.1 573 Sequence 7 from patent US 6153815
GI:8394354 GenBank EDM16202.1 573 squalene epoxidase [Rattus norvegicus]