Gene/Proteome Database (LMPD)

LMPD ID
LMP012578
Gene ID
29328
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 4
Gene Symbol
Gpx4
Synonyms
Phgpx; gpx-4; snGpx; Gshpx-4;
Alternate Names
phospholipid hydroperoxide glutathione peroxidase, nuclear; phospholipid hydroperoxide glutathione peroxidase, mitochondrial;
Chromosome
7
Map Location
7q11
EC Number
1.11.1.12
Summary
This gene encodes a member of the glutathione peroxidase protein family. Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Orthologs
View orthologs and multiple alignments for Gpx4

Proteins

phospholipid hydroperoxide glutathione peroxidase, nuclear isoform A precursor
Refseq ID NP_058861
Protein GI 90903249
UniProt ID P36970
mRNA ID NM_017165
Length 197
MSWGRLSRLLKPALLCGALAVPGLAGTMCASRDDWRCARSMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL
N sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2594 peptide sequence: MSWGRLSRLLKPALLCGALAVPGLA
phospholipid hydroperoxide glutathione peroxidase, nuclear isoform B
Refseq ID NP_001034938
Protein GI 90903229
UniProt ID Q91XR8
mRNA ID NM_001039849
Length 253
MGRAAARKRGRCRQRGRSPGGRRRREPGRQSPRKRPGPRRRRARARRRRRARPRRMEPIPEPFNPRPLLQDLPQTSNSHEFLGLCASRDDWRCARSMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL

Gene Information

Entrez Gene ID
29328
Gene Name
glutathione peroxidase 4
Gene Symbol
Gpx4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005743 IEA:Ensembl C mitochondrial inner membrane
GO:0005635 IEA:Ensembl C nuclear envelope
GO:0005634 ISS:UniProtKB C nucleus
GO:0043295 IDA:RGD F glutathione binding
GO:0004602 ISS:UniProtKB F glutathione peroxidase activity
GO:0047066 IDA:RGD F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0008430 IDA:RGD F selenium binding
GO:0007568 IEP:RGD P aging
GO:0006325 ISS:UniProtKB P chromatin organization
GO:0006749 IDA:RGD P glutathione metabolic process
GO:0042744 IDA:RGD P hydrogen peroxide catabolic process
GO:0007275 IEA:UniProtKB-KW P multicellular organismal development
GO:0050727 IMP:RGD P regulation of inflammatory response
GO:0032355 IEP:RGD P response to estradiol
GO:0007283 ISS:UniProtKB P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
ko00480 Glutathione metabolism
rno00480 Glutathione metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954556 Synthesis of 12-eicosatetraenoic acid derivatives
5954095 Synthesis of 5-eicosatetraenoic acids

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 4
Protein Entry
GPX42_RAT
UniProt ID
Q91XR8
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=Nuclear ; IsoId=Q91XR8-1; Sequence=Displayed; Name=Mitochondrial ; IsoId=P36970-1; Sequence=External; Name=Cytoplasmic; IsoId=P36970-2; Sequence=External; Note=Produced by alternative initiation at Met-28 of isoform Mitochondrial.;
Catalytic Activity 2 glutathione + a lipid hydroperoxide = glutathione disulfide + lipid + 2 H(2)O.
Function Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. Stabilizes the condensed chromatin in sperm nuclei and is necessary male fertility (By similarity)
Similarity Belongs to the glutathione peroxidase family
Subcellular Location Nucleus .

Identical and Related Proteins

Unique RefSeq proteins for LMP012578 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90903249 RefSeq NP_058861 197 phospholipid hydroperoxide glutathione peroxidase, nuclear isoform A precursor
90903229 RefSeq NP_001034938 253 phospholipid hydroperoxide glutathione peroxidase, nuclear isoform B

Identical Sequences to LMP012578 proteins

Reference Database Accession Length Protein Name
GI:90903229 SwissProt Q91XR8.3 253 RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, nuclear; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4 [Rattus norvegicus]
GI:90903249 SwissProt P36970.3 197 RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, mitochondrial; Short=PHGPx; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012578 proteins

Reference Database Accession Length Protein Name
GI:90903249 EMBL CAD61276.1 197 phospholipid hydroperoxide glutathione peroxidase [Rattus norvegicus]
GI:90903229 EMBL CAD61278.1 253 phospholipid hydroperoxide glutathione peroxidase [Rattus norvegicus]
GI:90903249 GenBank AAC52503.2 197 phospholipid hydroperoxide glutathione peroxidase [Rattus norvegicus]
GI:90903229 GenBank AAS76675.1 253 sperm nucleus phospholipid-hydroperoxide glutathione peroxidase [Rattus norvegicus]
GI:90903229 SwissProt Q91XR8.3 253 RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, nuclear; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4 [Rattus norvegicus]
GI:90903249 SwissProt P36970.3 197 RecName: Full=Phospholipid hydroperoxide glutathione peroxidase, mitochondrial; Short=PHGPx; AltName: Full=Glutathione peroxidase 4; Short=GPx-4; Short=GSHPx-4; Flags: Precursor [Rattus norvegicus]