Gene/Proteome Database (LMPD)
LMPD ID
LMP012595
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Synonyms
Nrbf1;
Alternate Names
trans-2-enoyl-CoA reductase, mitochondrial; NRBF-1; nuclear receptor binding factor 1; nuclear receptor-binding factor 1;
Chromosome
5
Map Location
5q36
EC Number
1.3.1.38
Summary
interacts with PPARalpha and with various nuclear hormone receptors [RGD, Feb 2006]
Orthologs
Proteins
trans-2-enoyl-CoA reductase, mitochondrial precursor | |
---|---|
Refseq ID | NP_058905 |
Protein GI | 8393848 |
UniProt ID | Q9Z311 |
mRNA ID | NM_017209 |
Length | 373 |
MLVSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGDPAKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSGLKPGDWVIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKDLKLRGFWLSQWKKNHSPDEFKELILILCNLIRQGQLTAPAWSGIPLQDYQQALEASMKPFVSLKQILTM | |
transit_peptide: 1..53 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9Z311.1) calculated_mol_wt: 5818 peptide sequence: MLVSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGD mat_peptide: 54..373 product: Trans-2-enoyl-CoA reductase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Z311.1) calculated_mol_wt: 34527 peptide sequence: PAKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSGLKPGDWVIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKDLKLRGFWLSQWKKNHSPDEFKELILILCNLIRQGQLTAPAWSGIPLQDYQQALEASMKPFVSLKQILTM |
Gene Information
Entrez Gene ID
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:UniProtKB | C | mitochondrion |
GO:0005102 | IDA:RGD | F | receptor binding |
GO:0019166 | ISS:UniProtKB | F | trans-2-enoyl-CoA reductase (NADPH) activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0006631 | ISS:UniProtKB | P | fatty acid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Protein Entry
MECR_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH. |
Caution | Was originally (PubMed:9795230) thought to be a nuclear protein that interact with nuclear receptor. However, it was shown later to be mitochondrial (PubMed:12654921), a function related to nuclear receptors being unsure. {ECO:0000305|PubMed:12654921, ECO:0000305|PubMed:9795230}. |
Function | Oxidoreductase with a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2- decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16). May play a role in mitochondrial fatty acid synthesis (By similarity) |
Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily |
Subcellular Location | Mitochondrion . |
Subunit | Homodimer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012595 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
8393848 | RefSeq | NP_058905 | 373 | trans-2-enoyl-CoA reductase, mitochondrial precursor |
Identical Sequences to LMP012595 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393848 | DBBJ | BAA34804.1 | 373 | nuclear receptor binding factor-1 [Rattus norvegicus] |
GI:8393848 | SwissProt | Q9Z311.1 | 373 | RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=NRBF-1; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012595 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8393848 | DBBJ | BAA34804.1 | 373 | nuclear receptor binding factor-1 [Rattus norvegicus] |
GI:8393848 | GenBank | EDL80610.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, isoform CRA_b [Rattus norvegicus] |
GI:8393848 | SwissProt | Q9Z311.1 | 373 | RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=NRBF-1; Flags: Precursor [Rattus norvegicus] |