Gene/Proteome Database (LMPD)

LMPD ID
LMP012595
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Synonyms
Nrbf1;
Alternate Names
trans-2-enoyl-CoA reductase, mitochondrial; NRBF-1; nuclear receptor binding factor 1; nuclear receptor-binding factor 1;
Chromosome
5
Map Location
5q36
EC Number
1.3.1.38
Summary
interacts with PPARalpha and with various nuclear hormone receptors [RGD, Feb 2006]
Orthologs

Proteins

trans-2-enoyl-CoA reductase, mitochondrial precursor
Refseq ID NP_058905
Protein GI 8393848
UniProt ID Q9Z311
mRNA ID NM_017209
Length 373
MLVSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGDPAKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSGLKPGDWVIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKDLKLRGFWLSQWKKNHSPDEFKELILILCNLIRQGQLTAPAWSGIPLQDYQQALEASMKPFVSLKQILTM
transit_peptide: 1..53 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9Z311.1) calculated_mol_wt: 5818 peptide sequence: MLVSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGD mat_peptide: 54..373 product: Trans-2-enoyl-CoA reductase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Z311.1) calculated_mol_wt: 34527 peptide sequence: PAKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSGLKPGDWVIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKDLKLRGFWLSQWKKNHSPDEFKELILILCNLIRQGQLTAPAWSGIPLQDYQQALEASMKPFVSLKQILTM

Gene Information

Entrez Gene ID
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:UniProtKB C mitochondrion
GO:0005102 IDA:RGD F receptor binding
GO:0019166 ISS:UniProtKB F trans-2-enoyl-CoA reductase (NADPH) activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0006631 ISS:UniProtKB P fatty acid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
M00085 Fatty acid biosynthesis, elongation, mitochondria
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR013154 Alcohol dehydrogenase GroES-like
IPR002085 Alcohol dehydrogenase superfamily, zinc-type
IPR013149 Alcohol dehydrogenase, C-terminal
IPR011032 GroES (chaperonin 10)-like
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Protein Entry
MECR_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH.
Caution Was originally (PubMed:9795230) thought to be a nuclear protein that interact with nuclear receptor. However, it was shown later to be mitochondrial (PubMed:12654921), a function related to nuclear receptors being unsure. {ECO:0000305|PubMed:12654921, ECO:0000305|PubMed:9795230}.
Function Oxidoreductase with a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2- decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16). May play a role in mitochondrial fatty acid synthesis (By similarity)
Similarity Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily
Subcellular Location Mitochondrion .
Subunit Homodimer

Identical and Related Proteins

Unique RefSeq proteins for LMP012595 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393848 RefSeq NP_058905 373 trans-2-enoyl-CoA reductase, mitochondrial precursor

Identical Sequences to LMP012595 proteins

Reference Database Accession Length Protein Name
GI:8393848 DBBJ BAA34804.1 373 nuclear receptor binding factor-1 [Rattus norvegicus]
GI:8393848 SwissProt Q9Z311.1 373 RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=NRBF-1; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012595 proteins

Reference Database Accession Length Protein Name
GI:8393848 DBBJ BAA34804.1 373 nuclear receptor binding factor-1 [Rattus norvegicus]
GI:8393848 GenBank EDL80610.1 373 mitochondrial trans-2-enoyl-CoA reductase, isoform CRA_b [Rattus norvegicus]
GI:8393848 SwissProt Q9Z311.1 373 RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=NRBF-1; Flags: Precursor [Rattus norvegicus]