Gene/Proteome Database (LMPD)
LMPD ID
LMP012602
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Alternate Names
phospholipase A2; group IB phospholipase A2; phospholipase A2 group IB; phospholipase A2, group 1B; phosphatidylcholine 2-acylhydrolase 1B;
Chromosome
12
Map Location
12q16
EC Number
3.1.1.4
Summary
putative phospholipase A2 enzyme [RGD, Feb 2006]
Orthologs
Proteins
| phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_113773 |
| Protein GI | 13928792 |
| UniProt ID | P04055 |
| mRNA ID | NM_031585 |
| Length | 146 |
| MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLDRCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICFSKVPYNKEYKDLDTKKHC | |
| sig_peptide: 1..15 calculated_mol_wt: 1528 peptide sequence: MKLLLLAALLTAGVT mat_peptide: 23..146 product: phospholipase A2 calculated_mol_wt: 14161 peptide sequence: AVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLDRCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICFSKVPYNKEYKDLDTKKHC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009986 | IDA:BHF-UCL | C | cell surface |
| GO:0005615 | IEA:Ensembl | C | extracellular space |
| GO:0030141 | IDA:RGD | C | secretory granule |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0047498 | IDA:RGD | F | calcium-dependent phospholipase A2 activity |
| GO:0004623 | IDA:BHF-UCL | F | phospholipase A2 activity |
| GO:0005102 | IDA:BHF-UCL | F | receptor binding |
| GO:0019731 | IEA:Ensembl | P | antibacterial humoral response |
| GO:0032869 | ISS:BHF-UCL | P | cellular response to insulin stimulus |
| GO:0050830 | IEA:Ensembl | P | defense response to Gram-positive bacterium |
| GO:0006633 | IDA:BHF-UCL | P | fatty acid biosynthetic process |
| GO:0015758 | ISS:BHF-UCL | P | glucose transport |
| GO:0002227 | IEA:Ensembl | P | innate immune response in mucosa |
| GO:0044240 | IEA:Ensembl | P | multicellular organismal lipid catabolic process |
| GO:0046470 | IEA:Ensembl | P | phosphatidylcholine metabolic process |
| GO:0006644 | IDA:RGD | P | phospholipid metabolic process |
| GO:0045740 | IDA:BHF-UCL | P | positive regulation of DNA replication |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00590 | Arachidonic acid metabolism |
| rno00590 | Arachidonic acid metabolism |
| ko00565 | Ether lipid metabolism |
| rno00565 | Ether lipid metabolism |
| ko04975 | Fat digestion and absorption |
| rno04975 | Fat digestion and absorption |
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| ko00591 | Linoleic acid metabolism |
| rno00591 | Linoleic acid metabolism |
| rno01100 | Metabolic pathways |
| ko04972 | Pancreatic secretion |
| rno04972 | Pancreatic secretion |
| rno04014 | Ras signaling pathway |
| ko04270 | Vascular smooth muscle contraction |
| rno04270 | Vascular smooth muscle contraction |
| ko00592 | alpha-Linolenic acid metabolism |
| rno00592 | alpha-Linolenic acid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5954464 | Acyl chain remodelling of PC |
| 5954471 | Acyl chain remodelling of PE |
| 5954465 | Acyl chain remodelling of PG |
| 5954468 | Acyl chain remodelling of PI |
| 5954470 | Acyl chain remodelling of PS |
| 5953473 | Glycerophospholipid biosynthesis |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953474 | Phospholipid metabolism |
| 5953472 | Synthesis of PA |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IB, pancreas
Protein Entry
PA21B_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 1 Ca(2+) ion per subunit. ; |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. |
| Ptm | Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically (By similarity) |
| Similarity | Belongs to the phospholipase A2 family |
| Subcellular Location | Secreted. Note=secreted from pancreatic acinar cells in its inactive form |
| Subunit | Monomer or homodimer. The inactive pro-form is a homotrimer (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP012602 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13928792 | RefSeq | NP_113773 | 146 | phospholipase A2 precursor |
Identical Sequences to LMP012602 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13928792 | GenBank | AAE33227.1 | 146 | Sequence 34 from patent US 5972677 |
| GI:13928792 | GenBank | AAE95394.1 | 146 | Sequence 34 from patent US 6352849 |
| GI:13928792 | GenBank | EDM13879.1 | 146 | phospholipase A2, group IB, isoform CRA_b [Rattus norvegicus] |
| GI:13928792 | GenBank | AEU43283.1 | 146 | Sequence 32 from patent US 8052970 |
Related Sequences to LMP012602 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13928792 | GenBank | AAE33227.1 | 146 | Sequence 34 from patent US 5972677 |
| GI:13928792 | GenBank | EDM13879.1 | 146 | phospholipase A2, group IB, isoform CRA_b [Rattus norvegicus] |
| GI:13928792 | GenBank | AEU43283.1 | 146 | Sequence 32 from patent US 8052970 |