Gene/Proteome Database (LMPD)
LMPD ID
LMP012611
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
WNT1 inducible signaling pathway protein 2
Gene Symbol
Synonyms
CCN5;
Alternate Names
WNT1-inducible-signaling pathway protein 2; CTGF-L; WISP-2; CCN family member 5; CCN family protein COP-1; connective tissue growth factor-like protein;
Chromosome
3
Map Location
3q42
Summary
involved in negative regulation of cell growth; mRNA expression is lost upon cell transformation induced by activated H-ras oncogene and inactivated p53 tumor supressor [RGD, Feb 2006]
Orthologs
Proteins
WNT1-inducible-signaling pathway protein 2 precursor | |
---|---|
Refseq ID | NP_113778 |
Protein GI | 13928802 |
UniProt ID | Q9JHC6 |
mRNA ID | NM_031590 |
Length | 250 |
MRGSPLIRLLATSFLCLLSMVCAQLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRLTESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQLSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAARSHSSWNSAF | |
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MRGSPLIRLLATSFLCLLSMVCA mat_peptide: 24..250 product: WNT1-inducible-signaling pathway protein 2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9JHC6.1) calculated_mol_wt: 24527 peptide sequence: QLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRLTESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQLSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAARSHSSWNSAF |
Gene Information
Entrez Gene ID
Gene Name
WNT1 inducible signaling pathway protein 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IDA:RGD | C | cell surface |
GO:0005737 | IDA:RGD | C | cytoplasm |
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0007155 | IEA:UniProtKB-KW | P | cell adhesion |
GO:0008285 | IDA:RGD | P | negative regulation of cell proliferation |
GO:0001558 | IEA:InterPro | P | regulation of cell growth |
Domain Information
UniProt Annotations
Entry Information
Gene Name
WNT1 inducible signaling pathway protein 2
Protein Entry
WISP2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity) |
Similarity | Belongs to the CCN family |
Similarity | Contains 1 IGFBP N-terminal domain |
Similarity | Contains 1 TSP type-1 domain. {ECO:0000255|PROSITE- ProRule:PRU00210}. |
Similarity | Contains 1 VWFC domain. {ECO:0000255|PROSITE- ProRule:PRU00220}. |
Subcellular Location | Secreted . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012611 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13928802 | RefSeq | NP_113778 | 250 | WNT1-inducible-signaling pathway protein 2 precursor |
Identical Sequences to LMP012611 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13928802 | GenBank | AAF69011.1 | 250 | CCN family protein COP-1 [Rattus norvegicus] |
GI:13928802 | SwissProt | Q9JHC6.1 | 250 | RecName: Full=WNT1-inducible-signaling pathway protein 2; Short=WISP-2; AltName: Full=CCN family member 5; AltName: Full=CCN family protein COP-1; AltName: Full=Connective tissue growth factor-like protein; Short=CTGF-L; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP012611 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13928802 | GenBank | AAF69011.1 | 250 | CCN family protein COP-1 [Rattus norvegicus] |
GI:13928802 | GenBank | EDL96560.1 | 250 | WNT1 inducible signaling pathway protein 2 [Rattus norvegicus] |
GI:13928802 | SwissProt | Q9JHC6.1 | 250 | RecName: Full=WNT1-inducible-signaling pathway protein 2; Short=WISP-2; AltName: Full=CCN family member 5; AltName: Full=CCN family protein COP-1; AltName: Full=Connective tissue growth factor-like protein; Short=CTGF-L; Flags: Precursor [Rattus norvegicus] |