Gene/Proteome Database (LMPD)

LMPD ID
LMP012611
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
WNT1 inducible signaling pathway protein 2
Gene Symbol
Synonyms
CCN5;
Alternate Names
WNT1-inducible-signaling pathway protein 2; CTGF-L; WISP-2; CCN family member 5; CCN family protein COP-1; connective tissue growth factor-like protein;
Chromosome
3
Map Location
3q42
Summary
involved in negative regulation of cell growth; mRNA expression is lost upon cell transformation induced by activated H-ras oncogene and inactivated p53 tumor supressor [RGD, Feb 2006]
Orthologs

Proteins

WNT1-inducible-signaling pathway protein 2 precursor
Refseq ID NP_113778
Protein GI 13928802
UniProt ID Q9JHC6
mRNA ID NM_031590
Length 250
MRGSPLIRLLATSFLCLLSMVCAQLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRLTESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQLSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAARSHSSWNSAF
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MRGSPLIRLLATSFLCLLSMVCA mat_peptide: 24..250 product: WNT1-inducible-signaling pathway protein 2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9JHC6.1) calculated_mol_wt: 24527 peptide sequence: QLCRTPCTCPWTPPQCPQGVPLVLDGCGCCKVCARRLTESCEHLHVCEPSQGLVCQPGAGPGGHGAVCLLDEDDGDCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVTLPSWDCPRPKRIQVPGKCCPEWVCDQGVTPAIQRSAAQGHQLSALVTPASADAPWPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLPRPCLAARSHSSWNSAF

Gene Information

Entrez Gene ID
Gene Name
WNT1 inducible signaling pathway protein 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IDA:RGD C cell surface
GO:0005737 IDA:RGD C cytoplasm
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0007155 IEA:UniProtKB-KW P cell adhesion
GO:0008285 IDA:RGD P negative regulation of cell proliferation
GO:0001558 IEA:InterPro P regulation of cell growth

Domain Information

InterPro Annotations

Accession Description
IPR000867 IGFBP-like
IPR009030 Insulin-like growth factor binding protein, N-terminal
IPR017891 Insulin_GF-bd_Cys-rich_CS
IPR000884 Thrombospondin_1_rpt
IPR001007 VWF_C

UniProt Annotations

Entry Information

Gene Name
WNT1 inducible signaling pathway protein 2
Protein Entry
WISP2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity)
Similarity Belongs to the CCN family
Similarity Contains 1 IGFBP N-terminal domain
Similarity Contains 1 TSP type-1 domain. {ECO:0000255|PROSITE- ProRule:PRU00210}.
Similarity Contains 1 VWFC domain. {ECO:0000255|PROSITE- ProRule:PRU00220}.
Subcellular Location Secreted .

Identical and Related Proteins

Unique RefSeq proteins for LMP012611 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13928802 RefSeq NP_113778 250 WNT1-inducible-signaling pathway protein 2 precursor

Identical Sequences to LMP012611 proteins

Reference Database Accession Length Protein Name
GI:13928802 GenBank AAF69011.1 250 CCN family protein COP-1 [Rattus norvegicus]
GI:13928802 SwissProt Q9JHC6.1 250 RecName: Full=WNT1-inducible-signaling pathway protein 2; Short=WISP-2; AltName: Full=CCN family member 5; AltName: Full=CCN family protein COP-1; AltName: Full=Connective tissue growth factor-like protein; Short=CTGF-L; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012611 proteins

Reference Database Accession Length Protein Name
GI:13928802 GenBank AAF69011.1 250 CCN family protein COP-1 [Rattus norvegicus]
GI:13928802 GenBank EDL96560.1 250 WNT1 inducible signaling pathway protein 2 [Rattus norvegicus]
GI:13928802 SwissProt Q9JHC6.1 250 RecName: Full=WNT1-inducible-signaling pathway protein 2; Short=WISP-2; AltName: Full=CCN family member 5; AltName: Full=CCN family protein COP-1; AltName: Full=Connective tissue growth factor-like protein; Short=CTGF-L; Flags: Precursor [Rattus norvegicus]