Gene/Proteome Database (LMPD)

LMPD ID
LMP012618
Gene ID
29632
Species
Rattus norvegicus (Rat)
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Gene Symbol
Hsd3b6
Synonyms
Hsd3b1;
Alternate Names
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4; 3-beta-HSD IV; 3 beta-hydroxysteroid dehydrogenase 6; hydroxysteroid dehydrogenase-6 delta<5>-3-beta; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IV; Hydroxy-delta-5-steroid dehydrogenase 3 beta- and steroid delta-isomerase;
Chromosome
2
Map Location
2q34
EC Number
1.1.1.145
Summary
enzyme responsible for the production of progesterone as well as the precursors of androgens, estrogens, glucocorticoids and mineralcorticoids [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hsd3b6

Proteins

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4
Refseq ID NP_058961
Protein GI 61889129
UniProt ID Q62878
mRNA ID NM_017265
Length 373
MPGWSCLVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLEGDILDTQCLRRACQGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAFIYCSTVDVAGPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERSPFLSVMILAALKSKGILNVTGKFSIANPVYVGNVAWAHILAARGLRDPKKSQNVQGQFYYISDDTPHQSYDDLNYTLSKEWGLHLDSSWSLPLPLLYWLAFLLEIVSFFLHPVYNYRPSFNRHLVTLSNSKFTFSYKKAQRDLGYKPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ

Gene Information

Entrez Gene ID
29632
Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Gene Symbol
Hsd3b6
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0003854 IDA:RGD F 3-beta-hydroxy-delta5-steroid dehydrogenase activity
GO:0016853 TAS:RGD F isomerase activity
GO:0004769 IDA:RGD F steroid delta-isomerase activity
GO:0030283 TAS:RGD F testosterone dehydrogenase [NAD(P)] activity
GO:0006700 IDA:RGD P C21-steroid hormone biosynthetic process
GO:0033327 IEP:RGD P Leydig cell differentiation
GO:0006702 IDA:RGD P androgen biosynthetic process
GO:0021766 IEP:RGD P hippocampus development
GO:0034757 IMP:RGD P negative regulation of iron ion transport
GO:0046686 IEP:RGD P response to cadmium ion
GO:0051412 IEP:RGD P response to corticosterone
GO:0034698 IEP:RGD P response to gonadotropin
GO:0010288 IEP:RGD P response to lead ion

KEGG Pathway Links

KEGG Pathway ID Description
M00110 C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
rno01100 Metabolic pathways
ko04913 Ovarian steroidogenesis
rno04913 Ovarian steroidogenesis
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis
M00107 Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone

REACTOME Pathway Links

REACTOME Pathway ID Description
5953941 Androgen biosynthesis
5953942 Glucocorticoid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953937 Metabolism of steroid hormones and vitamin D
5953936 Mineralocorticoid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002225 3-beta hydroxysteroid dehydrogenase/isomerase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6
Protein Entry
3BHS4_RAT
UniProt ID
Q62878
Species
Rat

Comments

Comment Type Description
Catalytic Activity A 3-beta-hydroxy-Delta(5)-steroid + NAD(+) = a 3-oxo-Delta(5)-steroid + NADH.
Catalytic Activity A 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)- steroid.
Function 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Pathway Lipid metabolism; steroid biosynthesis.
Similarity Belongs to the 3-beta-HSD family
Subcellular Location Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity Skin, placenta, also detectable in ovary and adrenal gland.

Identical and Related Proteins

Unique RefSeq proteins for LMP012618 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61889129 RefSeq NP_058961 373 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4

Identical Sequences to LMP012618 proteins

Reference Database Accession Length Protein Name
GI:61889129 GenBank AAH89937.1 373 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6 [Rattus norvegicus]
GI:61889129 GenBank EDL85560.1 373 rCG51795 [Rattus norvegicus]
GI:61889129 RefSeq XP_003749409.1 373 PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 [Rattus norvegicus]
GI:61889129 SwissProt Q62878.4 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4; AltName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IV; Short=3-beta-HSD IV; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=Progesterone reductase; Includes: RecName: Full=Steroid Delta-isomerase; AltName: Full=Delta-5-3-ketosteroid isomerase [Rattus norvegicus]

Related Sequences to LMP012618 proteins

Reference Database Accession Length Protein Name
GI:61889129 GenBank EDL85560.1 373 rCG51795 [Rattus norvegicus]
GI:61889129 RefSeq XP_003749409.1 373 PREDICTED: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 [Rattus norvegicus]
GI:61889129 SwissProt Q62878.4 373 RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4; AltName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IV; Short=3-beta-HSD IV; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene steroid dehydrogenase; AltName: Full=Progesterone reductase; Includes: RecName: Full=Steroid Delta-isomerase; AltName: Full=Delta-5-3-ketosteroid isomerase [Rattus norvegicus]