Gene/Proteome Database (LMPD)

LMPD ID
LMP012620
Gene ID
29640
Species
Rattus norvegicus (Rat)
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Dpm2
Alternate Names
dolichol phosphate-mannose biosynthesis regulatory protein; DPM synthase subunit 2; dolichol-phosphate mannosyltransferase 2; dolichol-phosphate mannose synthase subunit 2; dolichol-phosphate (beta-D) mannosyltransferase 2;
Chromosome
3
Map Location
chromosome:3
Summary
a regulatory enzyme; regulates biosynthesis of dolichol phosphate-mannose (DMP); catalytic activity is confered by binding partner DPM1 [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Dpm2

Proteins

dolichol phosphate-mannose biosynthesis regulatory protein
Refseq ID NP_062125
Protein GI 9506551
UniProt ID Q9Z325
mRNA ID NM_019252
Length 84
MATGTDQAVGFGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVLLPLAAGLLLLLFVGLFITYVLLKSQKVTKKAQ

Gene Information

Entrez Gene ID
29640
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene Symbol
Dpm2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0033185 IDA:MGI C dolichol-phosphate-mannose synthase complex
GO:0005783 IDA:MGI C endoplasmic reticulum
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0030176 IEA:InterPro C integral component of endoplasmic reticulum membrane
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0004582 IDA:MGI F dolichyl-phosphate beta-D-mannosyltransferase activity
GO:0030234 IDA:RGD F enzyme regulator activity
GO:0006506 IDA:MGI P GPI anchor biosynthetic process
GO:0019348 IDA:MGI P dolichol metabolic process
GO:0097502 IDA:GOC P mannosylation
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0050790 IDA:GOC P regulation of catalytic activity
GO:0031647 IEA:Ensembl P regulation of protein stability

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953345 Metabolism of proteins
5953735 Post-translational modification: synthesis of GPI-anchored proteins
5953728 Post-translational protein modification
5953736 Synthesis of dolichyl-phosphate mannose
5953734 Synthesis of glycosylphosphatidylinositol (GPI)
5953737 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR009914 Dolichol phosphate-mannose biosynthesis regulatory

UniProt Annotations

Entry Information

Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Protein Entry
DPM2_RAT
UniProt ID
Q9Z325
Species
Rat

Comments

Comment Type Description
Function Regulates the biosynthesis of dolichol phosphate- mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. When associated with the GPI-GlcNAc transferase (GPI-GnT) complex enhances but is not essential for its activity
Interaction Q9P2X0:DPM3 (xeno); NbExp=2; IntAct=EBI-9097185, EBI-9087337;
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DPM2 family
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit Component of the dolichol-phosphate mannose (DPM) synthase complex composed of DPM1, DPM2 and DPM3; in the complex interacts directly with DPM3. Associates with the GPI-GlcNAc transferase (GPI-GnT) complex

Identical and Related Proteins

Unique RefSeq proteins for LMP012620 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9506551 RefSeq NP_062125 84 dolichol phosphate-mannose biosynthesis regulatory protein

Identical Sequences to LMP012620 proteins

Reference Database Accession Length Protein Name
GI:9506551 DBBJ BAA33972.1 84 DPM2 [Rattus norvegicus]
GI:9506551 SwissProt Q9Z325.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Rattus norvegicus]

Related Sequences to LMP012620 proteins

Reference Database Accession Length Protein Name
GI:9506551 DBBJ BAA33972.1 84 DPM2 [Rattus norvegicus]
GI:9506551 RefSeq NP_034203.1 84 dolichol phosphate-mannose biosynthesis regulatory protein [Mus musculus]
GI:9506551 SwissProt Q9Z325.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Rattus norvegicus]