Gene/Proteome Database (LMPD)
Proteins
| arylacetamide deacetylase | |
|---|---|
| Refseq ID | NP_065413 |
| Protein GI | 10120490 |
| UniProt ID | Q9QZH8 |
| mRNA ID | NM_020538 |
| Length | 398 |
| MGRTIFLLISVVLVAYYIYIPLPDDIEEPWKIILGNTLLKLGGDLASFGELLGLNHFMDTVQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKSTTLRRGLFFIHGGGWCLGSAAYFMYDTLSRRTAHRLDAVVVSTDYGLAPKYHFPKQFEDVYHSLRWFLQEDILEKYGVDPRRVGVSGDSAGGNLTAAVTQQILQDPDVKIKLKVQALIYPALQALDMNVPSQQENSQYPLLTRSLLIRFWSEYFTTDRDLEKAMLLNQHVPVEFSHLLQFVNWSSLLPQRYKKGYFYKTPTPGSLELAQKYPGFTDVKACPLLANDSILHHLPMTYIITCQYDVLRDDGLMYVKRLQNTGVHVTHHHIEDGFHGALTLPGLKITYRMQNQYLNWLHKNL | |
Gene Information
Entrez Gene ID
Gene Name
arylacetamide deacetylase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | ISS:UniProtKB | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019213 | ISS:UniProtKB | F | deacetylase activity |
| GO:0004806 | IEA:UniProtKB-EC | F | triglyceride lipase activity |
| GO:0006629 | NAS:RGD | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
| Function | Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly (By similarity). Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. {ECO:0000250, ECO:0000269|PubMed:22207054}. |
| Similarity | Belongs to the 'GDXG' lipolytic enzyme family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein . Microsome membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Highest levels in liver with lower levels in jejunum, kidney and testis |
Identical and Related Proteins
Unique RefSeq proteins for LMP012658 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10120490 | RefSeq | NP_065413 | 398 | arylacetamide deacetylase |
Identical Sequences to LMP012658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10120490 | GenBank | AAD56394.1 | 398 | arylacetamide deacetylase [Rattus norvegicus] |
| GI:10120490 | GenBank | AAF74757.1 | 398 | arylacetamide deacetylase [Rattus norvegicus] |
| GI:10120490 | SwissProt | Q9QZH8.3 | 398 | RecName: Full=Arylacetamide deacetylase [Rattus norvegicus] |
Related Sequences to LMP012658 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10120490 | GenBank | AAD56394.1 | 398 | arylacetamide deacetylase [Rattus norvegicus] |
| GI:10120490 | GenBank | AAF74757.1 | 398 | arylacetamide deacetylase [Rattus norvegicus] |
| GI:10120490 | SwissProt | Q9QZH8.3 | 398 | RecName: Full=Arylacetamide deacetylase [Rattus norvegicus] |