Gene/Proteome Database (LMPD)
LMPD ID
LMP012659
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Synonyms
CB2; CB-2; CB2C; CNR2C;
Alternate Names
cannabinoid receptor 2; rCB2; CB2 receptor; peripheral cannabinoid receptor;
Chromosome
5
Map Location
5q36
Summary
G-protein-coupled transmembrane receptor; pertussis toxin-sensitive modulator of adenylate cyclase activity [RGD, Feb 2006]
Orthologs
Proteins
| cannabinoid receptor 2 isoform 1 | |
|---|---|
| Refseq ID | NP_001157614 |
| Protein GI | 255918134 |
| UniProt ID | Q9QZN9 |
| mRNA ID | NM_001164142 |
| Length | 360 |
| MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC | |
| cannabinoid receptor 2 isoform 1 | |
|---|---|
| Refseq ID | NP_001157615 |
| Protein GI | 255918136 |
| UniProt ID | Q9QZN9 |
| mRNA ID | NM_001164143 |
| Length | 360 |
| Protein sequence is identical to GI:255918134 (mRNA isoform) | |
| cannabinoid receptor 2 isoform 2 | |
|---|---|
| Refseq ID | NP_065418 |
| Protein GI | 255918132 |
| UniProt ID | Q9QZN9 |
| mRNA ID | NM_020543 |
| Length | 410 |
| MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAETLVLKDKQELGGDCLLRTSSIHSPMLSLADSANRQDVRPHCPEELTWWCSVRRPISLPNKAGQSTLL | |
Gene Information
Entrez Gene ID
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030425 | IDA:RGD | C | dendrite |
| GO:0031234 | IDA:RGD | C | extrinsic component of cytoplasmic side of plasma membrane |
| GO:0016021 | TAS:RGD | C | integral component of membrane |
| GO:0043005 | IDA:RGD | C | neuron projection |
| GO:0043025 | IDA:RGD | C | neuronal cell body |
| GO:0004930 | IDA:RGD | F | G-protein coupled receptor activity |
| GO:0004949 | IDA:RGD | F | cannabinoid receptor activity |
| GO:0007186 | IDA:RGD | P | G-protein coupled receptor signaling pathway |
| GO:0038171 | IDA:GOC | P | cannabinoid signaling pathway |
| GO:0006954 | IEA:UniProtKB-KW | P | inflammatory response |
| GO:0045759 | IMP:RGD | P | negative regulation of action potential |
| GO:0050728 | IDA:RGD | P | negative regulation of inflammatory response |
| GO:0033004 | IDA:RGD | P | negative regulation of mast cell activation |
| GO:0051001 | IMP:RGD | P | negative regulation of nitric-oxide synthase activity |
| GO:0032229 | IMP:RGD | P | negative regulation of synaptic transmission, GABAergic |
| GO:0001975 | IEP:RGD | P | response to amphetamine |
| GO:0032496 | IMP:RGD | P | response to lipopolysaccharide |
| GO:0019233 | IMP:RGD | P | sensory perception of pain |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04080 | Neuroactive ligand-receptor interaction |
| rno04080 | Neuroactive ligand-receptor interaction |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9QZN9-1; Sequence=Displayed; Note=No experimental confirmation available.; Name=2; IsoId=Q9QZN9-2; Sequence=VSP_036231; |
| Function | Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis (By similarity) |
| Ptm | Constitutively phosphorylated on Ser-352; phosphorylation increases cell internalization and desensitizes the receptor |
| Similarity | Belongs to the G-protein coupled receptor 1 family |
| Subcellular Location | Cell membrane ; Multi-pass membrane protein . Cell projection, dendrite . Perikaryon . Note=Localizes to apical dendrite of pyramidal neurons. |
| Tissue Specificity | Expressed in spleen and brain by neurons and glial cells (at protein level). Expressed in lung, testis and thymus but not in heart, liver or kidney. Expressed in cerebellum, cortex and brainstem. {ECO:0000269|PubMed:12084572, ECO:0000269|PubMed:12153574, ECO:0000269|PubMed:16224028, ECO:0000269|PubMed:18286196}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012659 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 255918134 | RefSeq | NP_001157614 | 360 | cannabinoid receptor 2 isoform 1 |
| 255918132 | RefSeq | NP_065418 | 410 | cannabinoid receptor 2 isoform 2 |
Identical Sequences to LMP012659 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:255918132 | GenBank | EDL80776.1 | 410 | cannabinoid receptor 2 (macrophage), isoform CRA_b [Rattus norvegicus] |
| GI:255918134 | GenBank | ACS88356.1 | 360 | CB2A isoform [Rattus norvegicus] |
| GI:255918136 | GenBank | ACS88356.1 | 360 | CB2A isoform [Rattus norvegicus] |
| GI:255918134 | GenBank | AFN80333.1 | 360 | CB2 receptor isoform C [Rattus norvegicus] |
| GI:255918136 | GenBank | AFN80333.1 | 360 | CB2 receptor isoform C [Rattus norvegicus] |
| GI:255918136 | GenBank | AFV26061.1 | 360 | Cnr2 isoform 2D [Rattus norvegicus] |
| GI:255918134 | GenBank | AFV26061.1 | 360 | Cnr2 isoform 2D [Rattus norvegicus] |
| GI:255918136 | RefSeq | NP_001157614.1 | 360 | cannabinoid receptor 2 isoform 1 [Rattus norvegicus] |
| GI:255918134 | RefSeq | NP_001157615.1 | 360 | cannabinoid receptor 2 isoform 1 [Rattus norvegicus] |
Related Sequences to LMP012659 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:255918132 | GenBank | AAG22010.1 | 410 | CB2 cannabinoid receptor [Rattus norvegicus] |
| GI:255918132 | GenBank | AAG22011.1 | 410 | peripheral cannabinoid receptor [Rattus norvegicus] |
| GI:255918132 | GenBank | EDL80776.1 | 410 | cannabinoid receptor 2 (macrophage), isoform CRA_b [Rattus norvegicus] |
| GI:255918134 | GenBank | ACS88355.1 | 360 | CB2B isoform [Rattus norvegicus] |
| GI:255918136 | GenBank | ACS88355.1 | 360 | CB2B isoform [Rattus norvegicus] |
| GI:255918134 | GenBank | AFN80333.1 | 360 | CB2 receptor isoform C [Rattus norvegicus] |
| GI:255918136 | GenBank | AFN80333.1 | 360 | CB2 receptor isoform C [Rattus norvegicus] |
| GI:255918136 | SwissProt | Q9QZN9.3 | 360 | RecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=CB2; Short=rCB2 [Rattus norvegicus] |
| GI:255918134 | SwissProt | Q9QZN9.3 | 360 | RecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=CB2; Short=rCB2 [Rattus norvegicus] |