Gene/Proteome Database (LMPD)

LMPD ID
LMP012659
Gene ID
57302
Species
Rattus norvegicus (Rat)
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Cnr2
Synonyms
CB2; CB-2; CB2C; CNR2C;
Alternate Names
cannabinoid receptor 2; rCB2; CB2 receptor; peripheral cannabinoid receptor;
Chromosome
5
Map Location
5q36
Summary
G-protein-coupled transmembrane receptor; pertussis toxin-sensitive modulator of adenylate cyclase activity [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cnr2

Proteins

cannabinoid receptor 2 isoform 1
Refseq ID NP_001157614
Protein GI 255918134
UniProt ID Q9QZN9
mRNA ID NM_001164142
Length 360
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
cannabinoid receptor 2 isoform 1
Refseq ID NP_001157615
Protein GI 255918136
UniProt ID Q9QZN9
mRNA ID NM_001164143
Length 360
Protein sequence is identical to GI:255918134 (mRNA isoform)
cannabinoid receptor 2 isoform 2
Refseq ID NP_065418
Protein GI 255918132
UniProt ID Q9QZN9
mRNA ID NM_020543
Length 410
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAETLVLKDKQELGGDCLLRTSSIHSPMLSLADSANRQDVRPHCPEELTWWCSVRRPISLPNKAGQSTLL

Gene Information

Entrez Gene ID
57302
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Cnr2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030425 IDA:RGD C dendrite
GO:0031234 IDA:RGD C extrinsic component of cytoplasmic side of plasma membrane
GO:0016021 TAS:RGD C integral component of membrane
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0004930 IDA:RGD F G-protein coupled receptor activity
GO:0004949 IDA:RGD F cannabinoid receptor activity
GO:0007186 IDA:RGD P G-protein coupled receptor signaling pathway
GO:0038171 IDA:GOC P cannabinoid signaling pathway
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0045759 IMP:RGD P negative regulation of action potential
GO:0050728 IDA:RGD P negative regulation of inflammatory response
GO:0033004 IDA:RGD P negative regulation of mast cell activation
GO:0051001 IMP:RGD P negative regulation of nitric-oxide synthase activity
GO:0032229 IMP:RGD P negative regulation of synaptic transmission, GABAergic
GO:0001975 IEP:RGD P response to amphetamine
GO:0032496 IMP:RGD P response to lipopolysaccharide
GO:0019233 IMP:RGD P sensory perception of pain

KEGG Pathway Links

KEGG Pathway ID Description
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR001551 Cannabinoid receptor type 2
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 2 (macrophage)
Protein Entry
CNR2_RAT
UniProt ID
Q9QZN9
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9QZN9-1; Sequence=Displayed; Note=No experimental confirmation available.; Name=2; IsoId=Q9QZN9-2; Sequence=VSP_036231;
Function Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis (By similarity)
Ptm Constitutively phosphorylated on Ser-352; phosphorylation increases cell internalization and desensitizes the receptor
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane ; Multi-pass membrane protein . Cell projection, dendrite . Perikaryon . Note=Localizes to apical dendrite of pyramidal neurons.
Tissue Specificity Expressed in spleen and brain by neurons and glial cells (at protein level). Expressed in lung, testis and thymus but not in heart, liver or kidney. Expressed in cerebellum, cortex and brainstem. {ECO:0000269|PubMed:12084572, ECO:0000269|PubMed:12153574, ECO:0000269|PubMed:16224028, ECO:0000269|PubMed:18286196}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012659 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
255918134 RefSeq NP_001157614 360 cannabinoid receptor 2 isoform 1
255918132 RefSeq NP_065418 410 cannabinoid receptor 2 isoform 2

Identical Sequences to LMP012659 proteins

Reference Database Accession Length Protein Name
GI:255918132 GenBank EDL80776.1 410 cannabinoid receptor 2 (macrophage), isoform CRA_b [Rattus norvegicus]
GI:255918134 GenBank ACS88356.1 360 CB2A isoform [Rattus norvegicus]
GI:255918136 GenBank ACS88356.1 360 CB2A isoform [Rattus norvegicus]
GI:255918134 GenBank AFN80333.1 360 CB2 receptor isoform C [Rattus norvegicus]
GI:255918136 GenBank AFN80333.1 360 CB2 receptor isoform C [Rattus norvegicus]
GI:255918136 GenBank AFV26061.1 360 Cnr2 isoform 2D [Rattus norvegicus]
GI:255918134 GenBank AFV26061.1 360 Cnr2 isoform 2D [Rattus norvegicus]
GI:255918136 RefSeq NP_001157614.1 360 cannabinoid receptor 2 isoform 1 [Rattus norvegicus]
GI:255918134 RefSeq NP_001157615.1 360 cannabinoid receptor 2 isoform 1 [Rattus norvegicus]

Related Sequences to LMP012659 proteins

Reference Database Accession Length Protein Name
GI:255918132 GenBank AAG22010.1 410 CB2 cannabinoid receptor [Rattus norvegicus]
GI:255918132 GenBank AAG22011.1 410 peripheral cannabinoid receptor [Rattus norvegicus]
GI:255918132 GenBank EDL80776.1 410 cannabinoid receptor 2 (macrophage), isoform CRA_b [Rattus norvegicus]
GI:255918134 GenBank ACS88355.1 360 CB2B isoform [Rattus norvegicus]
GI:255918136 GenBank ACS88355.1 360 CB2B isoform [Rattus norvegicus]
GI:255918134 GenBank AFN80333.1 360 CB2 receptor isoform C [Rattus norvegicus]
GI:255918136 GenBank AFN80333.1 360 CB2 receptor isoform C [Rattus norvegicus]
GI:255918136 SwissProt Q9QZN9.3 360 RecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=CB2; Short=rCB2 [Rattus norvegicus]
GI:255918134 SwissProt Q9QZN9.3 360 RecName: Full=Cannabinoid receptor 2; Short=CB-2; Short=CB2; Short=rCB2 [Rattus norvegicus]