Gene/Proteome Database (LMPD)
LMPD ID
LMP012663
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Synonyms
Ftc; Futb;
Alternate Names
galactoside 2-alpha-L-fucosyltransferase 2; alpha(1,2)FT 2; alpha 1-2 fucosyltransferase; alpha 12-fucosyltransferase C; alpha1,2-fucosyltransferase b; alpha 1,2-fucosyltransferase B; secretor blood group alpha-2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2;
Chromosome
1
Map Location
1q22-q31
EC Number
2.4.1.69
Summary
catalyzes the conversion of GDP-L-fucose and beta-D-galactosyl-R to GDP and alpha-L-fucosyl-(1,2)-beta-D-galactosyl-R [RGD, Feb 2006]
Orthologs
Proteins
| galactoside 2-alpha-L-fucosyltransferase 2 | |
|---|---|
| Refseq ID | NP_113823 |
| Protein GI | 13994175 |
| UniProt ID | Q10984 |
| mRNA ID | NM_031635 |
| Length | 354 |
| MASAQVPFSFPLAHFLIFVFVTSTIIHLQQRIVKLQPLSEKELPMTTQMSSGNTESPEMRRDSEQHGNGELRGMFTINSIGRLGNQMGEYATLFALARMNGRLAFIPASMHNALAPIFRISLPVLHSDTAKKIPWQNYHLNDWMEERYRHIPGHFVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLRVNGSQPSTFVGVHVRRGDYVHVMPNVWKGVVADRGYLEKALDMFRARYSSPVFVVTSNGMAWCRENINASRGDVVFAGNGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKVFKPEAAFLPEWVGIPADLSPLLKH | |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008107 | IDA:RGD | F | galactoside 2-alpha-L-fucosyltransferase activity |
| GO:0036065 | IDA:GOC | P | fucosylation |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002516 | Glycosyl transferase, family 11 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 2 (secretor status included)
Protein Entry
FUT2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q10984-1; Sequence=Displayed; Name=2; IsoId=Q10984-2; Sequence=VSP_016526; |
| Catalytic Activity | GDP-beta-L-fucose + beta-D-galactosyl-(1->3)- N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta- D-glucosyl-(1<->1)-ceramide = GDP + alpha-L-fucosyl-(1->2)-beta-D- galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide. |
| Function | Creates a membrane-associated precursor oligosaccharide Fuc-alpha((1,2)Gal-beta-) called the H antigen which is an essential substrate for the final step in the membrane-associated A and B antigen synthesis pathway |
| Miscellaneous | In rat, there are three genes (Fut1/Fta, Fut2/Ftb and Ftc) which encode galactoside 2-L-fucosyltransferase. They are expressed in a tissue-specific manner and Ftc may have no enzymatic activity. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 11 family |
| Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Membrane-bound form in trans cisternae of Golgi |
| Tissue Specificity | Specifically expressed in gut |
Identical and Related Proteins
Unique RefSeq proteins for LMP012663 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13994175 | RefSeq | NP_113823 | 354 | galactoside 2-alpha-L-fucosyltransferase 2 |
Identical Sequences to LMP012663 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13994175 | RefSeq | XP_006229201.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:13994175 | RefSeq | XP_006229202.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:13994175 | RefSeq | XP_006229203.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:13994175 | RefSeq | XP_008757634.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012663 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13994175 | DBBJ | BAA21742.1 | 354 | alpha 1,2-fucosyltransferase [Rattus norvegicus] |
| GI:13994175 | RefSeq | XP_006229192.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |
| GI:13994175 | RefSeq | XP_006229197.1 | 354 | PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus] |