Gene/Proteome Database (LMPD)

LMPD ID
LMP012663
Gene ID
58924
Species
Rattus norvegicus (Rat)
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Fut2
Synonyms
Ftc; Futb;
Alternate Names
galactoside 2-alpha-L-fucosyltransferase 2; alpha(1,2)FT 2; alpha 1-2 fucosyltransferase; alpha 12-fucosyltransferase C; alpha1,2-fucosyltransferase b; alpha 1,2-fucosyltransferase B; secretor blood group alpha-2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2;
Chromosome
1
Map Location
1q22-q31
EC Number
2.4.1.69
Summary
catalyzes the conversion of GDP-L-fucose and beta-D-galactosyl-R to GDP and alpha-L-fucosyl-(1,2)-beta-D-galactosyl-R [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fut2

Proteins

galactoside 2-alpha-L-fucosyltransferase 2
Refseq ID NP_113823
Protein GI 13994175
UniProt ID Q10984
mRNA ID NM_031635
Length 354
MASAQVPFSFPLAHFLIFVFVTSTIIHLQQRIVKLQPLSEKELPMTTQMSSGNTESPEMRRDSEQHGNGELRGMFTINSIGRLGNQMGEYATLFALARMNGRLAFIPASMHNALAPIFRISLPVLHSDTAKKIPWQNYHLNDWMEERYRHIPGHFVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLRVNGSQPSTFVGVHVRRGDYVHVMPNVWKGVVADRGYLEKALDMFRARYSSPVFVVTSNGMAWCRENINASRGDVVFAGNGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKVFKPEAAFLPEWVGIPADLSPLLKH

Gene Information

Entrez Gene ID
58924
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Fut2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008107 IDA:RGD F galactoside 2-alpha-L-fucosyltransferase activity
GO:0036065 IDA:GOC P fucosylation
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
rno00603 Glycosphingolipid biosynthesis - globo series
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002516 Glycosyl transferase, family 11

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 2 (secretor status included)
Protein Entry
FUT2_RAT
UniProt ID
Q10984
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q10984-1; Sequence=Displayed; Name=2; IsoId=Q10984-2; Sequence=VSP_016526;
Catalytic Activity GDP-beta-L-fucose + beta-D-galactosyl-(1->3)- N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta- D-glucosyl-(1<->1)-ceramide = GDP + alpha-L-fucosyl-(1->2)-beta-D- galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide.
Function Creates a membrane-associated precursor oligosaccharide Fuc-alpha((1,2)Gal-beta-) called the H antigen which is an essential substrate for the final step in the membrane-associated A and B antigen synthesis pathway
Miscellaneous In rat, there are three genes (Fut1/Fta, Fut2/Ftb and Ftc) which encode galactoside 2-L-fucosyltransferase. They are expressed in a tissue-specific manner and Ftc may have no enzymatic activity.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 11 family
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein . Note=Membrane-bound form in trans cisternae of Golgi
Tissue Specificity Specifically expressed in gut

Identical and Related Proteins

Unique RefSeq proteins for LMP012663 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13994175 RefSeq NP_113823 354 galactoside 2-alpha-L-fucosyltransferase 2

Identical Sequences to LMP012663 proteins

Reference Database Accession Length Protein Name
GI:13994175 RefSeq XP_006229201.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]
GI:13994175 RefSeq XP_006229202.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]
GI:13994175 RefSeq XP_006229203.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]
GI:13994175 RefSeq XP_008757634.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012663 proteins

Reference Database Accession Length Protein Name
GI:13994175 DBBJ BAA21742.1 354 alpha 1,2-fucosyltransferase [Rattus norvegicus]
GI:13994175 RefSeq XP_006229192.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]
GI:13994175 RefSeq XP_006229197.1 354 PREDICTED: galactoside 2-alpha-L-fucosyltransferase 2 isoform X1 [Rattus norvegicus]