Gene/Proteome Database (LMPD)

LMPD ID
LMP012666
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Synonyms
Degs;
Alternate Names
sphingolipid delta(4)-desaturase DES1; degenerative spermatocyte-like protein RDES; degenerative spermatocyte homolog 1, lipid desaturase;
Chromosome
13
Map Location
13q26
EC Number
1.14.-.-
Summary
human homolog is a member of a sphingolipid delta 4-desaturase enzyme family [RGD, Feb 2006]
Orthologs

Proteins

sphingolipid delta(4)-desaturase DES1
Refseq ID NP_445775
Protein GI 162287184
UniProt ID Q5XIF5
mRNA ID NM_053323
Length 323
MGNRVSREEFEWVYTDQPHAARRQEILAKYPEIKSLMKPDPNLIWIVTSMLLVQLASFYLVKDLDWKWLMFWSYAFGSCLNHSMTLAIHEISHNFPFGHHKAMWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADGIDVDIPTDFEGWFFCTTLRKLVWVILQPLFYAFRPLFINPKPITHLEVINTVIQVTFDVLVYYVFGVKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPLVRKIASEYYDNLPHYNSWIRVLYDFVMDDTISPYSRMKRPPKGNEIQE

Gene Information

Entrez Gene ID
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0030148 IEA:InterPro P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00094 Ceramide biosynthesis
rno01100 Metabolic pathways
ko00600 Sphingolipid metabolism
rno00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954266 Sphingolipid de novo biosynthesis
5954267 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR011388 Sphingolipid delta4-desaturase
IPR013866 Sphingolipid delta4-desaturase, N-terminal

UniProt Annotations

Entry Information

Gene Name
delta(4)-desaturase, sphingolipid 1
Protein Entry
DEGS1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine) (By similarity)
Ptm Myristoylation can target the enzyme to the mitochondria leading to an increase in ceramide levels
Similarity Belongs to the fatty acid desaturase family. DEGS subfamily
Subcellular Location Mitochondrion. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP012666 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
162287184 RefSeq NP_445775 323 sphingolipid delta(4)-desaturase DES1

Identical Sequences to LMP012666 proteins

Reference Database Accession Length Protein Name
GI:162287184 GenBank AAH83727.1 323 Degs1 protein [Rattus norvegicus]
GI:162287184 SwissProt Q5XIF5.1 323 RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1; AltName: Full=Degenerative spermatocyte-like protein RDES [Rattus norvegicus]

Related Sequences to LMP012666 proteins

Reference Database Accession Length Protein Name
GI:162287184 EMBL CAI79416.1 323 rat sphingolipid delta 4 desaturase [Rattus norvegicus]
GI:162287184 GenBank AAH83727.1 323 Degs1 protein [Rattus norvegicus]
GI:162287184 SwissProt Q5XIF5.1 323 RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1; AltName: Full=Degenerative spermatocyte-like protein RDES [Rattus norvegicus]