Gene/Proteome Database (LMPD)
LMPD ID
LMP012666
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Synonyms
Degs;
Alternate Names
sphingolipid delta(4)-desaturase DES1; degenerative spermatocyte-like protein RDES; degenerative spermatocyte homolog 1, lipid desaturase;
Chromosome
13
Map Location
13q26
EC Number
1.14.-.-
Summary
human homolog is a member of a sphingolipid delta 4-desaturase enzyme family [RGD, Feb 2006]
Orthologs
Proteins
sphingolipid delta(4)-desaturase DES1 | |
---|---|
Refseq ID | NP_445775 |
Protein GI | 162287184 |
UniProt ID | Q5XIF5 |
mRNA ID | NM_053323 |
Length | 323 |
MGNRVSREEFEWVYTDQPHAARRQEILAKYPEIKSLMKPDPNLIWIVTSMLLVQLASFYLVKDLDWKWLMFWSYAFGSCLNHSMTLAIHEISHNFPFGHHKAMWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADGIDVDIPTDFEGWFFCTTLRKLVWVILQPLFYAFRPLFINPKPITHLEVINTVIQVTFDVLVYYVFGVKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPLVRKIASEYYDNLPHYNSWIRVLYDFVMDDTISPYSRMKRPPKGNEIQE |
Gene Information
Entrez Gene ID
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0030148 | IEA:InterPro | P | sphingolipid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00094 | Ceramide biosynthesis |
rno01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
rno00600 | Sphingolipid metabolism |
M00099 | Sphingosine biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine) (By similarity) |
Ptm | Myristoylation can target the enzyme to the mitochondria leading to an increase in ceramide levels |
Similarity | Belongs to the fatty acid desaturase family. DEGS subfamily |
Subcellular Location | Mitochondrion. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012666 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
162287184 | RefSeq | NP_445775 | 323 | sphingolipid delta(4)-desaturase DES1 |
Identical Sequences to LMP012666 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:162287184 | GenBank | AAH83727.1 | 323 | Degs1 protein [Rattus norvegicus] |
GI:162287184 | SwissProt | Q5XIF5.1 | 323 | RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1; AltName: Full=Degenerative spermatocyte-like protein RDES [Rattus norvegicus] |
Related Sequences to LMP012666 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:162287184 | EMBL | CAI79416.1 | 323 | rat sphingolipid delta 4 desaturase [Rattus norvegicus] |
GI:162287184 | GenBank | AAH83727.1 | 323 | Degs1 protein [Rattus norvegicus] |
GI:162287184 | SwissProt | Q5XIF5.1 | 323 | RecName: Full=Sphingolipid delta(4)-desaturase DES1; AltName: Full=Degenerative spermatocyte homolog 1; AltName: Full=Degenerative spermatocyte-like protein RDES [Rattus norvegicus] |