Gene/Proteome Database (LMPD)

LMPD ID
LMP012687
Gene ID
64037
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Gene Symbol
Slc22a4
Synonyms
Octn1;
Alternate Names
solute carrier family 22 member 4; organic cation transporter OCTN1; organic cation/carnitine transporter 1; solute carrier family 22 (organic cation transporter), member 4;
Chromosome
10
Map Location
chromosome:10
Summary
mediates Na(+)-independent and pH-dependent transport of the prototypical organic cation tetraethylammonium [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Slc22a4

Proteins

solute carrier family 22 member 4
Refseq ID NP_071606
Protein GI 11560089
UniProt ID Q9R141
mRNA ID NM_022270
Length 553
MRDYDEVIAFLGDWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVPHTVNLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGLDVDLEQLEQESCLDGWEYSKDVFLSTIVTEWNLVCEDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMAVQTGFSFVQIFSTNWEMFTVLFAIVGMGQISNYVVAFILGTEILSKSVRILFSTLGVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFEEAEQIIQKAAKMNGIMAPAVIFDPLELQELNSLKQQKVFILDLFKTRNIATITVMSVMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFWGGGVLLLVQVVPEDYNFVSIGLVMLGKFGVTSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGIITLFFPESFGVTLPENLEQMQKVRGFRCGKKSTVSMDREENPKVLITAF

Gene Information

Entrez Gene ID
64037
Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Gene Symbol
Slc22a4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0015101 IDA:RGD F organic cation transmembrane transporter activity
GO:0015651 IDA:RGD F quaternary ammonium group transmembrane transporter activity
GO:0015293 IEA:UniProtKB-KW F symporter activity
GO:0015695 IDA:GOC P organic cation transport
GO:0015697 IDA:RGD P quaternary ammonium group transport
GO:0006814 IEA:UniProtKB-KW P sodium ion transport

Domain Information

InterPro Annotations

Accession Description
IPR005828 General substrate transporter
IPR020846 Major facilitator superfamily domain
IPR004749 Organic cation transport protein
IPR005829 Sugar transporter, conserved site

UniProt Annotations

Entry Information

Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Protein Entry
S22A4_RAT
UniProt ID
Q9R141
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is 8.0. At higher pH, transport activity decreases. ;
Caution It is unclear whether it transports carnitine in vivo
Function Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78
Miscellaneous Inhibited by desipramin > DMA > procainamide > cimetidine.
Similarity Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family
Subcellular Location Membrane ; Multi-pass membrane protein .
Subunit Interacts with PDZK1
Tissue Specificity Expressed in intestine, liver and kidney. Weakly expressed in brain, thymus, lung, spleen, heart and skin. In brain, it is expressed in cerebellum, especially in the granular layer, in hippocampus and cortex. In kidney, it is expressed in cortex and medulla with relatively more abundance in the cortical-medullary junction. In heart, it is expressed in myocardium and valves. Expressed labyrinthine zone of the placenta

Identical and Related Proteins

Unique RefSeq proteins for LMP012687 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11560089 RefSeq NP_071606 553 solute carrier family 22 member 4

Identical Sequences to LMP012687 proteins

Reference Database Accession Length Protein Name
GI:11560089 GenBank AAD46922.1 553 organic cation transporter OCTN1 [Rattus norvegicus]
GI:11560089 GenBank EDM04414.1 553 rCG34891, isoform CRA_b [Rattus norvegicus]
GI:11560089 SwissProt Q9R141.1 553 RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Rattus norvegicus]

Related Sequences to LMP012687 proteins

Reference Database Accession Length Protein Name
GI:11560089 GenBank AAD46922.1 553 organic cation transporter OCTN1 [Rattus norvegicus]
GI:11560089 GenBank EDM04414.1 553 rCG34891, isoform CRA_b [Rattus norvegicus]
GI:11560089 SwissProt Q9R141.1 553 RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Rattus norvegicus]