Gene/Proteome Database (LMPD)
LMPD ID
LMP012687
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Gene Symbol
Synonyms
Octn1;
Alternate Names
solute carrier family 22 member 4; organic cation transporter OCTN1; organic cation/carnitine transporter 1; solute carrier family 22 (organic cation transporter), member 4;
Chromosome
10
Map Location
chromosome:10
Summary
mediates Na(+)-independent and pH-dependent transport of the prototypical organic cation tetraethylammonium [RGD, Feb 2006]
Orthologs
Proteins
| solute carrier family 22 member 4 | |
|---|---|
| Refseq ID | NP_071606 |
| Protein GI | 11560089 |
| UniProt ID | Q9R141 |
| mRNA ID | NM_022270 |
| Length | 553 |
| MRDYDEVIAFLGDWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVPHTVNLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGLDVDLEQLEQESCLDGWEYSKDVFLSTIVTEWNLVCEDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMAVQTGFSFVQIFSTNWEMFTVLFAIVGMGQISNYVVAFILGTEILSKSVRILFSTLGVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFEEAEQIIQKAAKMNGIMAPAVIFDPLELQELNSLKQQKVFILDLFKTRNIATITVMSVMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFWGGGVLLLVQVVPEDYNFVSIGLVMLGKFGVTSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGIITLFFPESFGVTLPENLEQMQKVRGFRCGKKSTVSMDREENPKVLITAF | |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0015101 | IDA:RGD | F | organic cation transmembrane transporter activity |
| GO:0015651 | IDA:RGD | F | quaternary ammonium group transmembrane transporter activity |
| GO:0015293 | IEA:UniProtKB-KW | F | symporter activity |
| GO:0015695 | IDA:GOC | P | organic cation transport |
| GO:0015697 | IDA:RGD | P | quaternary ammonium group transport |
| GO:0006814 | IEA:UniProtKB-KW | P | sodium ion transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
solute carrier family 22 (organic cation/zwitterion transporter), member 4
Protein Entry
S22A4_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | pH dependence: Optimum pH is 8.0. At higher pH, transport activity decreases. ; |
| Caution | It is unclear whether it transports carnitine in vivo |
| Function | Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78 |
| Miscellaneous | Inhibited by desipramin > DMA > procainamide > cimetidine. |
| Similarity | Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Subunit | Interacts with PDZK1 |
| Tissue Specificity | Expressed in intestine, liver and kidney. Weakly expressed in brain, thymus, lung, spleen, heart and skin. In brain, it is expressed in cerebellum, especially in the granular layer, in hippocampus and cortex. In kidney, it is expressed in cortex and medulla with relatively more abundance in the cortical-medullary junction. In heart, it is expressed in myocardium and valves. Expressed labyrinthine zone of the placenta |
Identical and Related Proteins
Unique RefSeq proteins for LMP012687 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 11560089 | RefSeq | NP_071606 | 553 | solute carrier family 22 member 4 |
Identical Sequences to LMP012687 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11560089 | GenBank | AAD46922.1 | 553 | organic cation transporter OCTN1 [Rattus norvegicus] |
| GI:11560089 | GenBank | EDM04414.1 | 553 | rCG34891, isoform CRA_b [Rattus norvegicus] |
| GI:11560089 | SwissProt | Q9R141.1 | 553 | RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Rattus norvegicus] |
Related Sequences to LMP012687 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11560089 | GenBank | AAD46922.1 | 553 | organic cation transporter OCTN1 [Rattus norvegicus] |
| GI:11560089 | GenBank | EDM04414.1 | 553 | rCG34891, isoform CRA_b [Rattus norvegicus] |
| GI:11560089 | SwissProt | Q9R141.1 | 553 | RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Rattus norvegicus] |