Gene/Proteome Database (LMPD)

LMPD ID
LMP012689
Gene ID
64047
Species
Rattus norvegicus (Rat)
Gene Name
lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
Gene Symbol
Lrat
Alternate Names
lecithin retinol acyltransferase; phosphatidylcholine--retinol O-acyltransferase; lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase);
Chromosome
2
Map Location
2q34
EC Number
2.3.1.135
Summary
catalyzes the transfer of the sn-1 fatty acid of phosphatidylcholine to retinol bound to a cellular retinol-binding protein; may function to divert retinol into storage during vitamin A adequacy [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Lrat

Proteins

lecithin retinol acyltransferase
Refseq ID NP_071616
Protein GI 11560109
UniProt ID Q9JI61
mRNA ID NM_022280
Length 231
MKNSMLEAASLLLEKLLLISNFKIFSVCAPGGGTGKKHPYEINSFLRGDVLEVSRTHFTHYGIYLGDNRVAHLMPDILLALTSDKERTQKVVSNKRLLPGVICKVASIRVDTVEDFAYGADILVNHLDETLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSPISPQAEKFHETVKILIRDQRSCLASAVLGLVSIIYTGLASYMTLPAVCIPFCLWMMSG

Gene Information

Entrez Gene ID
64047
Gene Name
lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
Gene Symbol
Lrat
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0005771 IDA:UniProtKB C multivesicular body
GO:0048471 IDA:UniProtKB C perinuclear region of cytoplasm
GO:0005791 IDA:UniProtKB C rough endoplasmic reticulum
GO:0047173 IDA:RGD F phosphatidylcholine-retinol O-acyltransferase activity
GO:0001972 IDA:RGD F retinoic acid binding
GO:0019841 IDA:RGD F retinol binding
GO:0050896 IEA:UniProtKB-KW P response to stimulus
GO:0042573 IEP:RGD P retinoic acid metabolic process
GO:0042572 IDA:RGD P retinol metabolic process
GO:0007601 IEA:UniProtKB-KW P visual perception
GO:0006776 IDA:RGD P vitamin A metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00830 Retinol metabolism
rno00830 Retinol metabolism
ko04977 Vitamin digestion and absorption
rno04977 Vitamin digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953382 Diseases associated with visual transduction
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953384 The canonical retinoid cycle in rods (twilight vision)
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR007053 LRAT-like domain

UniProt Annotations

Entry Information

Gene Name
lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
Protein Entry
LRAT_RAT
UniProt ID
Q9JI61
Species
Rat

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + retinol--[cellular- retinol-binding-protein] = 2-acylglycerophosphocholine + retinyl- ester--[cellular-retinol-binding-protein].
Enzyme Regulation Inhibited by all-trans-retinyl alpha- bromoacetate and N-boc-L-biocytinyl-11-aminoundecane chloro-methyl ketone (BACMK)
Function Transfers the acyl group from the sn-1 position of phosphatidylcholine to all-trans retinol, producing all-trans retinyl esters. Retinyl esters are storage forms of vitamin A. LRAT plays a critical role in vision (By similarity). It provides the all-trans retinyl ester substrates for the isomerohydrolase which processes the esters into 11-cis-retinol in the retinal pigment epithelium; due to a membrane-associated alcohol dehydrogenase, 11 cis-retinol is oxidized and converted into 11- cis-retinaldehyde which is the chromophore for rhodopsin and the cone photopigments
Induction LRAT activity is up-regulated by dietary vitamin A. Under conditions of vitamin A depletion, LRAT expression in the liver is induced by retinoic acid. {ECO:0000269|PubMed:11108736, ECO:0000269|PubMed:1885578}.
Pathway Cofactor metabolism; retinol metabolism.
Similarity Belongs to the H-rev107 family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein . Rough endoplasmic reticulum . Endosome, multivesicular body . Cytoplasm, perinuclear region . Note=Present in the rough endoplasmic reticulum and multivesicular body in hepatic stellate cells. Present in the rough endoplasmic reticulum and perinuclear region in endothelial cells.
Tissue Specificity Hepatic stellate cells and endothelial cells (at protein level). Highly expressed in adrenal gland, small intestine, testis and eye. Lower levels of expression are observed in liver, heart, lung, skin, mammary tissue and skeletal muscle

Identical and Related Proteins

Unique RefSeq proteins for LMP012689 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11560109 RefSeq NP_071616 231 lecithin retinol acyltransferase

Identical Sequences to LMP012689 proteins

Reference Database Accession Length Protein Name
GI:11560109 GenBank AAF97786.1 231 lecithin retinol acyltransferase [Rattus norvegicus]
GI:11560109 GenBank EDM00844.1 231 rCG62473, isoform CRA_a [Rattus norvegicus]
GI:11560109 GenBank EDM00845.1 231 rCG62473, isoform CRA_a [Rattus norvegicus]
GI:11560109 SwissProt Q9JI61.1 231 RecName: Full=Lecithin retinol acyltransferase; AltName: Full=Phosphatidylcholine--retinol O-acyltransferase [Rattus norvegicus]

Related Sequences to LMP012689 proteins

Reference Database Accession Length Protein Name
GI:11560109 GenBank AAF97786.1 231 lecithin retinol acyltransferase [Rattus norvegicus]
GI:11560109 GenBank EDM00844.1 231 rCG62473, isoform CRA_a [Rattus norvegicus]
GI:11560109 GenBank EDM00845.1 231 rCG62473, isoform CRA_a [Rattus norvegicus]