Gene/Proteome Database (LMPD)

LMPD ID
LMP012702
Gene ID
64442
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
St3gal2
Synonyms
Siat5; Siat4b;
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; SIAT4-B; ST3GalII; ST3GALA.2; ST3Gal II; gal-NAc6S; alpha 2,3-ST 2; sialyltransferase 5; beta-galactoside alpha-2,3-sialyltransferase 2; gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4B (beta-galactoside alpha-2,3-sialyltransferase);
Chromosome
19
Map Location
19q12
EC Number
2.4.99.4
Summary
Gal beta 1,3GalNAc alpha 2,3-sialyltransferase with potential substrates of asialo-GM1 and GM1 [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for St3gal2

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
Refseq ID NP_113883
Protein GI 169636411
UniProt ID Q11205
mRNA ID NM_031695
Length 350
MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Gene Information

Entrez Gene ID
64442
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
St3gal2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003836 IEA:UniProtKB-EC F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0008373 IDA:RGD F sialyltransferase activity
GO:0006486 IDA:RGD P protein glycosylation
GO:0097503 IDA:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
rno00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00604 Glycosphingolipid biosynthesis - ganglio series
rno00604 Glycosphingolipid biosynthesis - ganglio series
ko00603 Glycosphingolipid biosynthesis - globo series
rno00603 Glycosphingolipid biosynthesis - globo series
rno01100 Metabolic pathways
ko00512 Mucin type O-Glycan biosynthesis
rno00512 Mucin type O-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954369 O-linked glycosylation
5954368 O-linked glycosylation of mucins
5953728 Post-translational protein modification
5954270 Sialic acid metabolism
5953737 Synthesis of substrates in N-glycan biosythesis
5954401 Termination of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Protein Entry
SIA4B_RAT
UniProt ID
Q11205
Species
Rat

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- 1,3-N-acetyl-alpha-D-galactosaminyl-R = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,3-N-acetyl-alpha-D- galactosaminyl-R.
Function It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
Pathway Protein modification; protein glycosylation.
Ptm The soluble form derives from the membrane form by proteolytic processing.
Similarity Belongs to the glycosyltransferase 29 family
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid.

Identical and Related Proteins

Unique RefSeq proteins for LMP012702 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
169636411 RefSeq NP_113883 350 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2

Identical Sequences to LMP012702 proteins

Reference Database Accession Length Protein Name
GI:169636411 GenBank EDL92553.1 350 ST3 beta-galactoside alpha-2,3-sialyltransferase 2, isoform CRA_a [Rattus norvegicus]
GI:169636411 RefSeq XP_006255687.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Rattus norvegicus]
GI:169636411 RefSeq XP_006255688.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Rattus norvegicus]
GI:169636411 RefSeq XP_006255689.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012702 proteins

Reference Database Accession Length Protein Name
GI:169636411 GenBank EDL92553.1 350 ST3 beta-galactoside alpha-2,3-sialyltransferase 2, isoform CRA_a [Rattus norvegicus]
GI:169636411 RefSeq XP_006255687.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Rattus norvegicus]
GI:169636411 RefSeq XP_006255688.1 350 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Rattus norvegicus]