Gene/Proteome Database (LMPD)

LMPD ID
LMP012703
Gene ID
64445
Species
Rattus norvegicus (Rat)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Gene Symbol
St3gal3
Synonyms
Siat6;
Alternate Names
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3N; ST3GalIII; ST3Gal III; alpha 2,3-ST 3; beta-galactoside alpha-2,3-sialyltransferase 3; N-acetyllacosaminide alpha 2,3-sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; sialyltransferase (N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 6(N-acetyllacosaminide alpha 23-sialyltransferase); sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase);
Chromosome
5
Map Location
5q36
EC Number
2.4.99.6
Summary
plays a role in the formation of terminal carbohydrate groups of glycolipids and glycoproteins [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for St3gal3

Proteins

CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
Refseq ID NP_113885
Protein GI 13928972
UniProt ID Q02734
mRNA ID NM_031697
Length 374
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLILSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALDGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Gene Information

Entrez Gene ID
64445
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Gene Symbol
St3gal3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0008118 TAS:RGD F N-acetyllactosaminide alpha-2,3-sialyltransferase activity
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0097503 TAS:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
rno00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways
ko00514 Other types of O-glycan biosynthesis
rno00514 Other types of O-glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954369 O-linked glycosylation
5954368 O-linked glycosylation of mucins
5953728 Post-translational protein modification
5954523 Pre-NOTCH Expression and Processing
5954524 Pre-NOTCH Processing in Golgi
5954270 Sialic acid metabolism
5953381 Signal Transduction
5953700 Signaling by NOTCH
5953737 Synthesis of substrates in N-glycan biosythesis
5954401 Termination of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3
Protein Entry
SIAT6_RAT
UniProt ID
Q02734
Species
Rat

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- (1->4)-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-D- glucosaminyl-glycoprotein.
Function Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta- 1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha- 2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3- GalNAc (By similarity)
Pathway Protein modification; protein glycosylation.
Ptm The soluble form derives from the membrane form by proteolytic processing.
Similarity Belongs to the glycosyltransferase 29 family
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid.
Tissue Specificity Found in all tissues tested. High expression found in brain, liver, kidney, colon, heart and lung.

Identical and Related Proteins

Unique RefSeq proteins for LMP012703 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13928972 RefSeq NP_113885 374 CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase

Identical Sequences to LMP012703 proteins

Reference Database Accession Length Protein Name
GI:13928972 EMBL CAS91694.1 374 unnamed protein product [Rattus rattus]
GI:13928972 GenBank AFG79767.1 374 Sequence 26 from patent US 8137928
GI:13928972 GenBank AFN90553.1 374 Sequence 76 from patent US 8198045
GI:13928972 SwissProt Q02734.1 374 RecName: Full=CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; AltName: Full=Beta-galactoside alpha-2,3-sialyltransferase 3; Short=Alpha 2,3-ST 3; AltName: Full=Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; AltName: Full=N-acetyllactosaminide alpha-2,3-sialyltransferase; AltName: Full=ST3Gal III; Short=ST3GalIII; AltName: Full=ST3N; AltName: Full=Sialyltransferase 6; Contains: RecName: Full=CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase soluble form [Rattus norvegicus]

Related Sequences to LMP012703 proteins

Reference Database Accession Length Protein Name
GI:13928972 GenBank AAA42146.1 374 CMP-N-acetylneuraminate-beta-galactoside alpha-2-3-sialyltransferase [Rattus norvegicus]
GI:13928972 GenBank AFG79767.1 374 Sequence 26 from patent US 8137928
GI:13928972 SwissProt Q02734.1 374 RecName: Full=CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; AltName: Full=Beta-galactoside alpha-2,3-sialyltransferase 3; Short=Alpha 2,3-ST 3; AltName: Full=Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; AltName: Full=N-acetyllactosaminide alpha-2,3-sialyltransferase; AltName: Full=ST3Gal III; Short=ST3GalIII; AltName: Full=ST3N; AltName: Full=Sialyltransferase 6; Contains: RecName: Full=CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase soluble form [Rattus norvegicus]