Gene/Proteome Database (LMPD)
LMPD ID
LMP012714
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
oleoyl-ACP hydrolase
Gene Symbol
Synonyms
Mch; Thedc1;
Alternate Names
S-acyl fatty acid synthase thioesterase, medium chain; thioesterase II; thioesterase domain containing 1; thioesterase domain-containing protein 1; medium-chain S-acyl fatty acid synthetase thio ester hydrolase (MCH);
Chromosome
17
Map Location
17q12.3
EC Number
3.1.2.14
Summary
expressed in mammary gland [RGD, Feb 2006]
Orthologs
Proteins
| S-acyl fatty acid synthase thioesterase, medium chain | |
|---|---|
| Refseq ID | NP_073196 |
| Protein GI | 12083671 |
| UniProt ID | P08635 |
| mRNA ID | NM_022705 |
| Length | 263 |
| METAVNAKSPRNEKVLNCLYQNPDAVFKLICFPWAGGGSIHFAKWGQKINDSLEVHAVRLAGRETRLGEPFANDIYQIADEIVTALLPIIQDKAFAFFGHSFGSYIALITALLLKEKYKMEPLHIFVSGASAPHSTSRPQVPDLNELTEEQVRHHLLDFGGTPKHLIEDQDVLRMFIPLLKADAGVVKKFIFDKPSKALLSLDITGFLGSEDTIKDIEGWQDLTSGKFDVHMLPGDHFYLMKPDNENFIKNYIAKCLELSSLT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016295 | IEA:UniProtKB-EC | F | myristoyl-[acyl-carrier-protein] hydrolase activity |
| GO:0004320 | IEA:UniProtKB-EC | F | oleoyl-[acyl-carrier-protein] hydrolase activity |
| GO:0016296 | IEA:UniProtKB-EC | F | palmitoyl-[acyl-carrier-protein] hydrolase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Oleoyl-[acyl-carrier-protein] + H(2)O = [acyl- carrier-protein] + oleate. |
| Function | In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2). |
| Similarity | Belongs to the thioesterase family |
| Subunit | Monomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012714 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 12083671 | RefSeq | NP_073196 | 263 | S-acyl fatty acid synthase thioesterase, medium chain |
Identical Sequences to LMP012714 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:12083671 | GenBank | EDL78698.1 | 263 | thioesterase domain containing 1, isoform CRA_a [Rattus norvegicus] |
| GI:12083671 | GenBank | EDL78699.1 | 263 | thioesterase domain containing 1, isoform CRA_a [Rattus norvegicus] |
| GI:12083671 | RefSeq | XP_008770108.1 | 263 | PREDICTED: S-acyl fatty acid synthase thioesterase, medium chain isoform X1 [Rattus norvegicus] |
| GI:12083671 | RefSeq | XP_008770109.1 | 263 | PREDICTED: S-acyl fatty acid synthase thioesterase, medium chain isoform X1 [Rattus norvegicus] |
Related Sequences to LMP012714 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:12083671 | EMBL | CAA68411.1 | 263 | unnamed protein product [Rattus norvegicus] |
| GI:12083671 | GenBank | AAQ52093.1 | 263 | Sequence 3 from patent US 6593099 |
| GI:12083671 | SwissProt | P08635.1 | 263 | RecName: Full=S-acyl fatty acid synthase thioesterase, medium chain; AltName: Full=Oleoyl-ACP hydrolase; AltName: Full=Thioesterase II; AltName: Full=Thioesterase domain-containing protein 1 [Rattus norvegicus] |