Gene/Proteome Database (LMPD)

LMPD ID
LMP012714
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
oleoyl-ACP hydrolase
Gene Symbol
Synonyms
Mch; Thedc1;
Alternate Names
S-acyl fatty acid synthase thioesterase, medium chain; thioesterase II; thioesterase domain containing 1; thioesterase domain-containing protein 1; medium-chain S-acyl fatty acid synthetase thio ester hydrolase (MCH);
Chromosome
17
Map Location
17q12.3
EC Number
3.1.2.14
Summary
expressed in mammary gland [RGD, Feb 2006]
Orthologs

Proteins

S-acyl fatty acid synthase thioesterase, medium chain
Refseq ID NP_073196
Protein GI 12083671
UniProt ID P08635
mRNA ID NM_022705
Length 263
METAVNAKSPRNEKVLNCLYQNPDAVFKLICFPWAGGGSIHFAKWGQKINDSLEVHAVRLAGRETRLGEPFANDIYQIADEIVTALLPIIQDKAFAFFGHSFGSYIALITALLLKEKYKMEPLHIFVSGASAPHSTSRPQVPDLNELTEEQVRHHLLDFGGTPKHLIEDQDVLRMFIPLLKADAGVVKKFIFDKPSKALLSLDITGFLGSEDTIKDIEGWQDLTSGKFDVHMLPGDHFYLMKPDNENFIKNYIAKCLELSSLT

Gene Information

Entrez Gene ID
Gene Name
oleoyl-ACP hydrolase
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016295 IEA:UniProtKB-EC F myristoyl-[acyl-carrier-protein] hydrolase activity
GO:0004320 IEA:UniProtKB-EC F oleoyl-[acyl-carrier-protein] hydrolase activity
GO:0016296 IEA:UniProtKB-EC F palmitoyl-[acyl-carrier-protein] hydrolase activity
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00061 Fatty acid biosynthesis
rno00061 Fatty acid biosynthesis
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR001031 Thioesterase
IPR012223 Thioesterase type II, NRPS/PKS/S-FAS

UniProt Annotations

Entry Information

Gene Name
oleoyl-ACP hydrolase
Protein Entry
SAST_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Oleoyl-[acyl-carrier-protein] + H(2)O = [acyl- carrier-protein] + oleate.
Function In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2).
Similarity Belongs to the thioesterase family
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP012714 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
12083671 RefSeq NP_073196 263 S-acyl fatty acid synthase thioesterase, medium chain

Identical Sequences to LMP012714 proteins

Reference Database Accession Length Protein Name
GI:12083671 GenBank EDL78698.1 263 thioesterase domain containing 1, isoform CRA_a [Rattus norvegicus]
GI:12083671 GenBank EDL78699.1 263 thioesterase domain containing 1, isoform CRA_a [Rattus norvegicus]
GI:12083671 RefSeq XP_008770108.1 263 PREDICTED: S-acyl fatty acid synthase thioesterase, medium chain isoform X1 [Rattus norvegicus]
GI:12083671 RefSeq XP_008770109.1 263 PREDICTED: S-acyl fatty acid synthase thioesterase, medium chain isoform X1 [Rattus norvegicus]

Related Sequences to LMP012714 proteins

Reference Database Accession Length Protein Name
GI:12083671 EMBL CAA68411.1 263 unnamed protein product [Rattus norvegicus]
GI:12083671 GenBank AAQ52093.1 263 Sequence 3 from patent US 6593099
GI:12083671 SwissProt P08635.1 263 RecName: Full=S-acyl fatty acid synthase thioesterase, medium chain; AltName: Full=Oleoyl-ACP hydrolase; AltName: Full=Thioesterase II; AltName: Full=Thioesterase domain-containing protein 1 [Rattus norvegicus]